(data stored in ACNUC7421 zone)

EMBL: CP001825.PE278

CP001825.PE278       Location/Qualifiers
FT   CDS_pept        complement(299491..300057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0280"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41202"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE46"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ACZ41202.1"
FT                   /translation="MKKRLLKIVLLSLTLISCGASSEATPTLPVSQGLPSIVPTTISMP
FT                   TPIPTEEHIASPTPVPSISPITTPTVTEISPSPAASTPPTGSEYSITVTAKGLAFDVKT
FT                   ITVQPGQLVVIKFKNEDSVPHNMAFYTDKTAKEKIFVGKIINGPSSTTYRFKAPNRPGN
FT                   YFFRCDVHPQIMTGTFIVQAKEPGY"
     atgaagaaga gactactaaa gatagtactc ttgtcattaa ctcttattag ctgcggagcg        60
     tctagtgagg ctacccctac cttgccagta tctcagggat taccttcgat tgtccctact       120
     actatttcca tgcctacgcc tattcccaca gaggaacaca tagccagtcc cacccctgtg       180
     ccatcgatta gcccaattac cactccaacg gtcacggaga tatcgccgag tccggctgcc       240
     agcacgcctc caacgggtag tgagtattcc attactgtta ctgcgaaggg actcgcgttt       300
     gatgtgaaga ctataactgt gcaacccgga cagttggttg ttattaagtt caaaaacgaa       360
     gactctgttc ctcacaacat ggctttttac actgataaaa ctgctaagga aaaaatattt       420
     gtgggaaaga taatcaatgg ccctagcagc acgacatatc ggtttaaagc tccaaacaga       480
     cctgggaact acttcttcag atgcgatgtt caccctcaga taatgacggg cacatttatc       540
     gtacaggcca aagagccagg ttattag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page