(data stored in ACNUC7421 zone)

EMBL: CP001825.PE279

CP001825.PE279       Location/Qualifiers
FT   CDS_pept        complement(300102..300905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0281"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   acp:A2cp1_3352 protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41203"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE47"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ACZ41203.1"
FT                   /translation="MSNFPDTPDKNTPCQVTLRFYAELNDFLPADKRQQDWLIDLDRRT
FT                   SIKDLVESLGVPHTEVDLLVANGDIIDFSYVPKCGDRISVYPEFRSLSLGHHLKPDLDP
FT                   NPKFVLDAHLGKLAGYLRMLGFDTIYDPDSSDLDLAFASKADGRILLTRDIGLLKRKIV
FT                   FRGYYVRETEPKRQIIEVIKQFKLLDKINPFGRCAHCNDLLIDVPKREIIHLLLPKTIL
FT                   YYDEFRRCRGCGKIYWKGSHHEAILRLIESIQEEVSLEPKRLQTS"
     atgagcaact ttcctgatac gccagataaa aatactcctt gccaagttac tcttaggttc        60
     tacgcagagc taaacgattt cctacctgct gacaagaggc aacaagattg gctgatagat       120
     ctcgatagaa ggacgtcgat caaagacctt gtagagtctt taggcgtacc ccataccgag       180
     gttgacctgc tggttgctaa tggagacatc atagatttct cctacgttcc caagtgtggt       240
     gacaggataa gtgtatatcc agaattcaga tctttatcct tgggtcatca tctcaagcct       300
     gatctagatc caaatccaaa gtttgttcta gatgctcatc tgggcaagtt ggctggttat       360
     cttaggatgc taggattcga tactatctat gatcccgact cttcagatct ggatctggcg       420
     tttgcctcaa aggccgatgg cagaatactt cttacaaggg atattgggct cttgaagaga       480
     aaaatagttt tcagaggtta ttatgtgaga gaaaccgaac cgaagaggca gatcatagaa       540
     gtgataaagc agttcaagct gcttgataag atcaatcctt ttggtaggtg tgcgcactgc       600
     aatgatctac tgatagatgt ccctaagcgt gagatcattc atcttctact gccaaagacc       660
     atactttact acgacgagtt caggagatgc cgtggttgtg ggaagatcta ttggaaggga       720
     agtcaccatg aggctatcct gaggctgatt gaatccattc aagaagaagt gagcttagaa       780
     ccaaaaaggc ttcagacttc gtag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page