(data stored in ACNUC7421 zone)

EMBL: CP001825.PE283

CP001825.PE283       Location/Qualifiers
FT   CDS_pept        complement(305809..307101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0285"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: dal:Dalk_2855
FT                   glutamate-1-semialdehyde-2,1- aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41207"
FT                   /db_xref="GOA:D1CE51"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE51"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ACZ41207.1"
FT                   /translation="MKILANNSSKLFQRAQKVMPGGVSSPVRAFRAVGGEPIFIDKAQG
FT                   SRLFDVDGKEYIDFVGSWGPMILGHAHPEVLRLIHEAVDKGTSFGAPNQYELQLAEMVT
FT                   SLVPSVDVVRFVNSGTEATMSAVRLARAVTSRDLVVKFDGCYHGHADFFLVAAGSGAMT
FT                   LGQPDSLGVPNQIASLTASLPYNDIEHVTTFFQERGNEIAAVIVEPVAGNMGVVLPKQD
FT                   FLAKLRELTSKYGALLIFDEVITGFRLSLGGAQQLFDIKPDITTLGKIIGGGLPVGAYG
FT                   GTAEIMNMLAPNGPVYQAGTLSGNPIAMAAGYKTIHILQQDEGVYERLDYMGSYLEKGL
FT                   QDAAKDAGVGVTINRAGSMLTIFFSSYPVSNYQDAKRSDTTMFAKFHSNMLAQGIYLPP
FT                   SQFEAWFLSTAHTREDLDRTIEAAYTALKKI"
     atgaaaatcc tggcaaataa ctcctccaaa ttgttccaac gtgctcagaa ggtgatgcct        60
     ggtggagtga gcagcccggt tagggctttt agagctgtag gaggagaacc tatatttata       120
     gacaaggcgc agggctctcg tttatttgat gtagatggca aggagtatat agacttcgtt       180
     ggatcctggg gtcccatgat ccttggtcat gcccaccccg aagtgttgag gcttattcac       240
     gaagctgtgg ataaaggtac gagttttggc gcacctaatc aatatgagct gcagcttgct       300
     gagatggtta ctagtcttgt tccgagcgta gatgtagtaa ggttcgtcaa ttctggaacc       360
     gaagctacta tgagcgcggt acgcttggca agagctgtaa cctcgcgaga tctagtagta       420
     aagtttgatg gctgctatca tggacatgca gatttctttc tcgttgcagc tggctcgggt       480
     gccatgactc tagggcaacc agatagcctt ggagtgccca atcagatagc ttccctcaca       540
     gcctctttgc cttacaacga cattgaacat gtcactacct ttttccaaga aagaggcaat       600
     gagatagctg cagttatagt ggaacctgtt gcaggtaata tgggagtcgt gctacctaag       660
     caagatttcc ttgcgaaatt gcgcgagctg acatctaaat atggtgcact ccttatattt       720
     gacgaagtta tcactgggtt caggctatcg ttaggtggag cacagcagct atttgatata       780
     aaacccgata taacaactct ggggaagata ataggcggag ggcttcccgt tggtgcctat       840
     ggtgggactg cagagatcat gaacatgtta gcccctaacg gtcctgttta tcaggctggc       900
     actctgtccg gtaaccctat agcaatggcg gcaggttaca agaccattca tatactacaa       960
     caggatgaag gtgtgtatga acgcctagac tatatgggat catatctaga aaaaggtctc      1020
     caagatgccg cgaaggatgc tggtgtaggg gttactatca acagagcagg ttccatgcta      1080
     actattttct tctccagcta tccagtttct aactatcaag atgccaagcg aagcgatacc      1140
     actatgtttg ctaagttcca ttcaaatatg ctggcgcaag gcatctattt accgcccagc      1200
     caattcgagg cctggttctt atccactgct catactcgcg aagatctaga tagaactata      1260
     gaagcggcct acacagccct taagaagata taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page