(data stored in ACNUC7421 zone)

EMBL: CP001825.PE284

CP001825.PE284       Location/Qualifiers
FT   CDS_pept        complement(307082..308341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0286"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: pca:Pcar_3064 glutamyl-tRNA reductase;
FT                   TIGRFAM: glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41208"
FT                   /db_xref="GOA:D1CE52"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE52"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ACZ41208.1"
FT                   /translation="MSGIFLTGINHTTANADIRERLYLSDPDIATLLAKLNQRFEEAVV
FT                   LSTCNRLEIYIYDSSPDHRYVVSCISSLVNAPEEQITSHSYTKSDREAVYHLMSVAAGL
FT                   DSVVLGESQILGQVRQAWEKAASLDTTGPVLNTLFRYALQAGKDVRTKVPIGRGATSVA
FT                   HAAVELTRSRFGSLRDLCVVVLGAGEMGRLAARNLRSAGVKRITIINRTYERAKFLAED
FT                   IGGEAVPIEDMDLALASADVLITCSLSPRPLVLTSHLEHAVRYKQDRQLLVIDIAIPRN
FT                   VDPQVRSLPSVSLYDMDDIQEICNRNRHARKMAARLAHKELQYWVEEFFKWQHERLAVP
FT                   LIRDVRGKAEQIRKDRLEKTFGILKDLTDEQRYVIDAMSKSIVNAILHNPTIWIKQVED
FT                   EDLKRLFADMWGVNHENPGK"
     ttgagtggta tatttctaac gggaatcaat catactacag ctaacgcaga tatcagggag        60
     aggctatatc tgtctgatcc tgatatcgcg actctacttg ccaaactcaa tcaaaggttt       120
     gaagaggccg tggtcctctc gacctgcaac agattagaga tatatatcta tgattcgtct       180
     cctgaccata gatacgtagt ttcctgcata tcctccttgg taaatgctcc tgaggagcag       240
     ataacatctc attcatacac gaaatctgat cgcgaagccg tctaccacct tatgtctgta       300
     gctgctggtc ttgattcagt ggtgctggga gagtcccaga tattagggca agtcagacag       360
     gcttgggaaa aggcagcttc tctggatacc actggtcctg tactgaatac cctgtttagg       420
     tatgccctcc aggcaggcaa agatgtaaga acgaaagtgc ccataggaag gggtgctacg       480
     tcggttgcgc acgctgcggt ggagctgact aggtctcgct ttggcagctt gcgggatctc       540
     tgcgtagtag tgcttggcgc tggagagatg ggaagattag ctgctagaaa ccttagatcg       600
     gctggcgtca agaggataac tataatcaat agaacctacg aaagagctaa gttcctagca       660
     gaagacatag gtggggaagc tgtaccgata gaagatatgg atcttgctct ggcttctgct       720
     gatgtactga ttacttgctc gctctctcct agacccctag tgcttaccag ccatctggag       780
     catgcagtca gatataagca agatcgacag ttattagtaa tagacatcgc tatacctagg       840
     aatgtagatc cccaagtacg tagtctgcct tccgttagct tgtacgatat ggacgatata       900
     caggagatat gtaatagaaa caggcatgca aggaagatgg cagcacgtct agcgcacaag       960
     gagctgcagt attgggttga ggagttcttc aagtggcagc atgagaggct agctgttcct      1020
     ctaatccgag atgtgcgtgg caaggcagag cagatccgta aagataggct agagaaaacc      1080
     ttcggaatac taaaggacct cactgatgaa cagaggtatg taatagatgc gatgagcaag      1140
     tccatagtca atgccatact tcacaatccc acgatatgga taaagcaggt agaggacgag      1200
     gacttaaaga ggctcttcgc ggacatgtgg ggggtaaatc atgaaaatcc tggcaaataa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page