(data stored in ACNUC7421 zone)

EMBL: CP001825.PE286

CP001825.PE286       Location/Qualifiers
FT   CDS_pept        complement(309192..310064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0288"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; CoA- binding
FT                   domain protein; KEGG: bsu:BSU16100 succinyl-CoA synthetase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41210"
FT                   /db_xref="GOA:D1CE54"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE54"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ACZ41210.1"
FT                   /translation="MSILVDKNTRLLVQGITGREGSFHTQQMVEYGTNVVAGVTPGAAG
FT                   REVCGVPVYNTVREAVEATGANTSIVYVPAPFAPDAVYEAASAGISLIVCITEHIPAVD
FT                   EVKMYHYVREKGSRLIGPNCPGLTTPGEAKVGIIPGNIHKRGPVGIVSRSGTLTYEAVA
FT                   ALTAADIGQSTVVGIGGDPIVGTSFREVLEMFEDDPETHAVVLIGEIGGNAEEEAAEYI
FT                   RQMTKPVVAFIAGRTAPPGRRMGHAGAIISGGSGTAESKIRALEGANAHIAETPSQIAE
FT                   LVEVALAGA"
     gtgagcatac tggtagacaa gaatacgagg cttcttgtgc agggtataac cggtcgggag        60
     ggatcctttc atacccagca gatggttgag tacggaacca acgtagtggc tggtgtgacg       120
     ccaggagcag cagggcggga agtttgtggg gttcctgtct acaacactgt aagagaagct       180
     gtggaggcca cgggcgctaa cacctcgata gtctatgttc ctgcaccttt tgcccctgat       240
     gcggtctacg aggctgcctc agctggaata tccctcatag tgtgcataac tgagcacata       300
     ccagctgttg atgaggtaaa gatgtaccat tatgtcaggg agaagggtag tagactgata       360
     ggccctaatt gtccagggct gactacgcca ggggaagcca aggtaggtat aatcccaggc       420
     aatatacaca agcgtgggcc agtaggcata gtatcccgct ctggcacact aacttatgag       480
     gcggtggctg cccttacagc ggctgacata ggacaaagta cggtcgtggg tataggtggt       540
     gatcctattg tgggcacaag ctttcgtgaa gtgctagaga tgtttgaaga tgatcccgag       600
     acgcacgccg tggtacttat tggagagatc ggtgggaacg ccgaagagga ggctgcagaa       660
     tacataagac agatgacgaa gcccgtggtt gcctttatag cgggtcgcac tgcacctcct       720
     ggccgtagaa tgggacatgc aggggcgata ataagcggtg gtagtggtac agcagagagc       780
     aagattcgag ctcttgaagg tgccaacgct catatagctg aaacgccatc gcaaatagca       840
     gagcttgttg aggttgccct ggctggcgcc taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page