(data stored in ACNUC7421 zone)

EMBL: CP001825.PE288

CP001825.PE288       Location/Qualifiers
FT   CDS_pept        complement(311364..312365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0290"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: mxa:MXAN_0643 sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41212"
FT                   /db_xref="GOA:D1CE56"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE56"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ41212.1"
FT                   /translation="MKTSEKLWIYSLVEAMPVALLVFDRDANLLAASPKARAMLLPISK
FT                   GDNHNGSLENPALPASIRESLYRVLKGYSRSESGHATIANTRIEFTVADIGDVVSVAFS
FT                   DPSPGYDENIDYLSIAAHELKTPLTAIKGGTQLLERTLLRNGDLSDRESKLLGMIISQV
FT                   NRLSYMVDSLLDTSRLASGRIKLTKSDHDLRMIVQEAVEEVRSSIPGRNIDIKMPSHEL
FT                   RANIDPVRLSQVIENILRNAVENSDPDKAVLVEAYEDMDDIYLTVTDYGKGIQPKDSPH
FT                   IFEKFYRGAECSGGLGLGLYISSELVKLHGGRIWFESEPGYGTTFYIAIPAR"
     atgaagactt ctgagaagtt gtggatatac agcttagtag aggcgatgcc ggtagcgttg        60
     ttggtctttg atcgtgatgc aaatcttctg gctgcatctc ccaaggcccg tgcgatgctg       120
     ctacccatta gcaaaggtga taatcataac ggctcattag aaaatcctgc tctaccggcg       180
     agcatccgcg agtctttgta tagggttctg aaggggtact cgcgttctga gagtggacat       240
     gcaaccattg caaatacacg catcgagttc acggttgctg acataggaga cgtagtgagt       300
     gtagccttta gtgacccctc tccaggatac gatgaaaata ttgattatct atccatagct       360
     gctcatgaac tcaagactcc tctaaccgct attaaaggag gcacacagct tctggagagg       420
     acactgctga gaaatggcga cctgagcgat agagaatcga agttactggg catgataatc       480
     tcgcaggtta acagattatc ctatatggtt gatagtctgt tagatacctc tagattagct       540
     tcaggcagga taaagcttac caaaagcgat catgacctac gtatgatagt acaggaagct       600
     gtggaagaag taaggtcatc gattcctggt cgaaacatag acataaagat gccttcacac       660
     gagctgcgtg caaacataga tcctgtaaga ctgtctcagg tgatcgagaa tatcttacgc       720
     aatgctgtag agaactcaga tccagacaaa gcagtgctag tggaagcata tgaggatatg       780
     gatgatatat acctgacggt tactgattat ggcaaaggta tacagcctaa ggacagccct       840
     catatattcg agaaatttta caggggagcc gaatgtagcg gagggctcgg tctaggcctc       900
     tatatatctt cagagctcgt aaagcttcac ggcgggcgta tatggtttga gtcagagcca       960
     ggttatggta ccacttttta catagctatc ccggccaggt aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page