(data stored in ACNUC7421 zone)

EMBL: CP001825.PE289

CP001825.PE289       Location/Qualifiers
FT   CDS_pept        312497..313933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0291"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; KEGG: pau:PA14_57940 RNA polymerase
FT                   factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41213"
FT                   /db_xref="GOA:D1CE57"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE57"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACZ41213.1"
FT                   /translation="MDMQMSQEQNQAQEMTIKASPSLIEANYILSLSLPELRQTILNEL
FT                   SQNPALELVDHETCPFCGEVMVGGKCENCSREDSKTDHTDTVNEDLDSLYYESYSATSR
FT                   SLVSDDEDDFDPMSIVASEQDFHESLRSDLHSILPEEDYEIADYLIESLDENGYLRQPL
FT                   DAIARELGRDVQRVEWVLQRLQEIAPAGVGARNLQECLLLQLRYLEQEGEIIPEYVRAI
FT                   LENYIEELGSHKYGYIARKLKTSPEKVAEARQFIKQKLSPYPSLDPAVGRTWKSPSRST
FT                   YISPDVIIFEREGKLEVEVVEGRQFELRLSPAYQQIAKDLEAHPNSYSENERTHIKEYI
FT                   SRTKMFISNVNQRRKTIYKIASALVELQEDFIRYGVRHLKPLTRAMLADYIGVHESTVS
FT                   RATAGKYVMLPNRKVIPFSDFFTASLSIKDVIKEIIMSEDKALTDRQICDKLRERGIRV
FT                   ARRTVAKYRAELGILPSTLR"
     atggatatgc agatgtcgca ggaacaaaat caagcgcaag agatgactat aaaagcttct        60
     ccctcgctga tagaggcaaa ctacatactt agtttgtccc taccagagct gcgacagacg       120
     atactaaacg agctaagcca gaatcctgct ctcgagctag tggaccacga aacttgcccc       180
     ttttgtggcg aagtcatggt aggtggcaaa tgcgagaact gttctcggga agactctaaa       240
     acagatcata ctgataccgt caacgaggat ctggattctc tgtactatga aagctactca       300
     gcaacatcgc gttcgttagt atctgatgat gaagatgact ttgaccccat gtccatagtg       360
     gcatccgagc aggattttca tgaatcactg aggtcggatc tacattcaat actccctgaa       420
     gaagactacg agatagctga ctacctaata gagtccctgg atgagaatgg ttaccttagg       480
     caaccgctgg atgctatagc tcgtgagctg gggagggatg tgcagagggt agaatgggta       540
     ctacagagat tacaggagat agcacccgcg ggtgtaggtg caaggaatct tcaagaatgt       600
     ctactgctcc agctgagata tctggagcaa gagggagaaa tcatacccga gtacgtaaga       660
     gccatcctag agaactatat cgaagagctg gggagtcata aatacggcta catagctagg       720
     aagctgaaga cctctcctga aaaagtagct gaagctaggc agttcattaa gcagaaacta       780
     tctccttatc cttcacttga tcctgcagtt ggacgtacat ggaaaagccc ctccaggtcc       840
     acttacatct ctcctgatgt catcatattt gagagagaag gcaagctaga ggtagaagtg       900
     gtcgagggta ggcagttcga gcttcggtta agtccagcat accagcagat cgcaaaagac       960
     ctggaagcac atccgaactc ttattcggag aacgagagaa ctcatatcaa ggagtacatc      1020
     tcgcgtacga agatgtttat ttcgaacgta aaccagcgcc gcaagactat atacaaaata      1080
     gcctccgctc tggtcgagct gcaagaggat tttataagat atggagtcag acatctaaag      1140
     cctctaacta gagctatgct cgcagactac ataggggtac atgagagcac agtcagccgc      1200
     gccactgctg gcaaatatgt aatgttgcct aacaggaaag ttataccttt ttcagacttc      1260
     tttaccgctt cacttagcat caaagacgtg atcaaagaga tcataatgag cgaggataaa      1320
     gctctgaccg atcgacaaat atgcgataag ctacgtgaga gaggaataag agtagcgcga      1380
     agaacagtgg ccaaatatag ggctgagctt ggcatacttc cttctactct aagataa         1437
//

If you have problems or comments...

PBIL Back to PBIL home page