(data stored in ACNUC7421 zone)

EMBL: CP001825.PE293

CP001825.PE293       Location/Qualifiers
FT   CDS_pept        complement(316528..316872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0295"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="TIGRFAM: S-adenosylmethionine decarboxylase
FT                   proenzyme; PFAM: S-adenosylmethionine decarboxylase
FT                   related; KEGG: gdi:GDI2320 putaive S-adenosylmethionine
FT                   decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41217"
FT                   /db_xref="GOA:D1CE61"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE61"
FT                   /inference="protein motif:TFAM:TIGR03330"
FT                   /protein_id="ACZ41217.1"
FT                   /translation="MSFRHILYDLWVEDPSILERTKPLEQIMLEAARCSGATILHSYFH
FT                   QFDPHGVSGVVLIAQSHLSIHTWSEEKYAAIDVFTYQGMNPELAISYIREKLRPTRERI
FT                   TDLSRGGTLL"
     atgtccttcc ggcatatact atatgatctc tgggtagaag atccctctat actggaacgt        60
     accaagcctt tagagcagat aatgctcgag gctgcgcgtt gcagtggtgc cacaatactt       120
     cattcgtact tccaccagtt tgatcctcat ggcgtgtctg gtgttgtgct gatcgctcaa       180
     tctcacctct ccatccacac ctggtctgag gaaaaatatg ctgctatcga tgtcttcaca       240
     taccagggta tgaatcccga gctagctata agctatataa gagagaagct gcgacctacc       300
     agagagagaa taacggatct tagccgaggg ggaacactgt tatag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page