(data stored in ACNUC7421 zone)

EMBL: CP001825.PE296

CP001825.PE296       Location/Qualifiers
FT   CDS_pept        complement(318777..319460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0298"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; BAAT/Acyl-CoA
FT                   thioester hydrolase; KEGG: scl:sce0062 putative
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41220"
FT                   /db_xref="GOA:D1CE64"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE64"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ACZ41220.1"
FT                   /translation="MGEMVTFPSNGTTAEGYLAKPDTDKAPGVLVIQEWWGLNDNIKSI
FT                   CERFASEGFLALAPDLYHGRATTEPDEARKLAMSLQMETAAKDMSGAVDYLREHAGYTS
FT                   VGAVGYCMGGGLALFIAALRGDVVKAVVPFYGLVPPSAPPVDWSKLQASVLGHYAELDQ
FT                   GITVERVREFENQLKSLGKEVEIHIYQGAQHGFCNDTRPQVYNREACELAWQRTIAFLR
FT                   KKLVS"
     atgggtgaga tggttacctt tccaagcaat ggcactactg ctgagggtta tcttgccaag        60
     ccagatactg acaaagcccc gggtgtgtta gtaatacagg aatggtgggg gctgaacgac       120
     aatatcaaga gcatatgtga aaggtttgct tcggaagggt tcctggcact agccccagac       180
     ctctatcatg gacgagcaac taccgagcca gatgaagcca ggaagcttgc tatgtctctt       240
     caaatggaga cagcagccaa agacatgagt ggtgcagtgg attatcttag ggagcatgct       300
     gggtatacat ctgtgggagc agtgggctac tgtatgggcg gaggacttgc tctgttcata       360
     gctgctctta gaggtgatgt ggtcaaggca gtggtgcctt tctacggttt agtgcctccg       420
     tctgcgcctc ctgtggactg gagcaagctg caggcctcgg tgctcggcca ctatgcggag       480
     ttggatcaag gcataaccgt agaaagggta agagaatttg agaatcagct gaagtccttg       540
     ggtaaagaag ttgagatcca tatataccag ggagcacagc atggcttttg taacgacact       600
     agaccacagg tatacaacag ggaagcctgt gagctagctt ggcagagaac tattgccttt       660
     ctgcgtaaga agttggttag ctag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page