(data stored in ACNUC7421 zone)

EMBL: CP001825.PE297

CP001825.PE297       Location/Qualifiers
FT   CDS_pept        complement(319483..320118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0299"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   aba:Acid345_3436 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41221"
FT                   /db_xref="GOA:D1CE65"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE65"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACZ41221.1"
FT                   /translation="MEEIAPSIARYLDALVPERTGDMVIMEDYAKAHGFPIIGPSAGYF
FT                   CYLMTRVMGARKVFELGSGYGYSTAWFARGVHENGGGVVHHTVWDSNLSNMARLHLKNM
FT                   GYENIVVYHIGEAVETLRNTDDTFDIVFNDIDKSAYPDSLPVIKSKLKKGGMLIVDNIL
FT                   WHGRILDPSERSRDTEAIRVMIDMVRNDPEWIYSIVPLRDGLLLAYKQ"
     atggaagaga ttgctccaag tatagctaga tatctggatg ccctcgtgcc ggagagaacc        60
     ggtgatatgg tgatcatgga agattatgct aaagcccatg gctttccgat cattggccca       120
     tcagcaggat atttttgtta ccttatgacc agggtgatgg gtgctagaaa ggtttttgag       180
     ttaggttctg gttacgggta ctccaccgct tggttcgcaa ggggtgtgca cgagaatggt       240
     ggtggggtgg ttcaccacac cgtttgggac tcaaacttgt caaatatggc gcgcttacat       300
     ctaaagaata tgggatacga gaacatagtt gtctaccata taggggaagc ggttgagacc       360
     cttagaaata cggacgatac tttcgatata gtgttcaatg atatagataa gtctgcttac       420
     cctgattctc tgcccgtaat caaaagcaag ctgaagaaag gtggcatgct catagtagat       480
     aacatcctct ggcatgggag gatactagat ccttccgaaa ggtctagaga caccgaggct       540
     ataagagtta tgatcgatat ggtcagaaat gatccagagt ggatctatag catagtacct       600
     ctaagagatg gtcttttact tgcttacaag cagtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page