(data stored in ACNUC7421 zone)

EMBL: CP001825.PE298

CP001825.PE298       Location/Qualifiers
FT   CDS_pept        320229..320903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0300"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; KEGG: bha:BH2213 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41222"
FT                   /db_xref="GOA:D1CE66"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE66"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ41222.1"
FT                   /translation="MQEEQVSGTEAIRVVIAEDHALVREGTKELLEKRGIRVIGEASNG
FT                   EEAVELAQKLQPDLILMDVSMPKLNGIDATKIIKQKHPNIAVLVLSAYDDDQYVFALLQ
FT                   AGAAGYILKDAHADEVVNAVKAVANGESVLAPSIAKKVLSRFTSPSTQPEHPSPVLTDR
FT                   ELDVLRLAAKGESNKAIAQQLHLSPRTVQVHLSNIFNKFGVASRTEAVLHALKLGLIDL
FT                   SE"
     atgcaggaag agcaggttag cgggacagag gctatccgtg tagtgatagc tgaggatcat        60
     gctctcgtga gggaaggaac aaaggagctc ctcgagaagc gaggtataag ggtaataggg       120
     gaggcttcaa atggcgagga ggctgtagag cttgcccaaa agctccaacc agacctgatc       180
     ttgatggatg taagcatgcc aaagctaaat ggcatagatg ccacgaagat tatcaagcaa       240
     aaacatccaa atatagctgt tcttgttctc agtgcgtatg acgatgatca gtatgtgttt       300
     gcgctccttc aagcaggggc agcaggttac atactgaagg acgcacatgc tgatgaagtc       360
     gtgaacgcgg tgaaggcggt cgctaatgga gagtctgtac ttgcgccttc catagccaag       420
     aaagtgcttt caaggtttac atctcctagt acacagcctg aacatccaag ccctgttcta       480
     actgataggg agctagatgt cttaaggtta gcggcaaagg gagagagcaa caaggcaatt       540
     gcccaacaat tacatctgag tccccgtacc gttcaggtac acttgagcaa tatatttaat       600
     aaatttggtg ttgcatcaag gacagaagct gtgctgcatg ctctcaagtt ggggcttata       660
     gacctttcgg agtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page