(data stored in ACNUC7421 zone)

EMBL: CP001825.PE3

CP001825.PE3         Location/Qualifiers
FT   CDS_pept        2349..3311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0003"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   afr:AFE_2515 ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40927"
FT                   /db_xref="GOA:D1CDC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ40927.1"
FT                   /translation="MRIRLAKLSDSKQLVDILASSFAEEISLSNLNRDSIKAQVSLGTI
FT                   ASYPWLRHLLRVMGVTLEFWVAEEDGQVLGCVMLHSTKRRLPLNISSLAVHPEHRHKGI
FT                   GRSLMSVMFQRTKQLGRNIITLEVMTDNTPAVNLYRSLGMEEYDRRLSYRYIVNPMTIG
FT                   TDLSGVSLSPVNRADIPLWREIINTSPNVPIKLEQIMRVYEEEYISRAQRNLWLPSILG
FT                   RLSTYQQYAIYNQGKTVGFVAARNMLRGNPTESLPPLCLPQAGLNMTSVFIRLQEMLLQ
FT                   YGSRAHRLYVSAFDGNQIEAAQMLGYRFEKSWSYMYKRL"
     atgcgcataa ggctagcaaa actatctgac tccaaacagc tggtcgatat cctcgcatct        60
     tcctttgcag aggagatatc gctttctaac ctgaatcgag attcgatcaa ggctcaggtg       120
     tcgctaggaa ctatcgccag ctatccctgg ttacgacacc ttctcagggt gatgggggta       180
     acccttgagt tctgggtagc tgaagaagat ggtcaggtat taggttgcgt gatgctacat       240
     tctacaaaga gaaggctccc tctgaacata agcagcctgg cagtacatcc tgaacacaga       300
     cacaagggca tcggaaggag cctaatgagc gtcatgtttc aaagaacaaa acagcttggc       360
     agaaatatca tcaccctcga agtcatgacc gacaacactc ctgccgtgaa cctataccga       420
     tcactgggaa tggaggaata cgacaggagg ctcagctaca gatacatagt caatcctatg       480
     accattggta cagacctttc tggagtttcg ctctcacccg taaacagagc cgatatacct       540
     ctatggaggg agataataaa cacaagcccg aatgtgccca tcaagctaga gcaaatcatg       600
     agagtgtacg aagaggaata catctccaga gctcagagaa acttatggct gccttcgata       660
     cttggcagat tatctactta ccagcagtat gcaatatata accaggggaa aacagtaggg       720
     ttcgttgcag ctagaaacat gctacgcggc aaccccaccg aaagtcttcc ccctttatgc       780
     ttgcctcaag cgggattgaa catgacaagc gtttttatta ggttacaaga gatgctacta       840
     caatacgggt ctcgggctca tcgcttatac gtctcggctt ttgacggaaa ccagatagaa       900
     gccgctcaga tgcttggata cagattcgag aagagctggt cctatatgta caagaggctc       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page