(data stored in ACNUC7421 zone)

EMBL: CP001825.PE300

CP001825.PE300       Location/Qualifiers
FT   CDS_pept        323589..324815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0302"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   tgr:Tgr7_1190 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41224"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE68"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACZ41224.1"
FT                   /translation="MHNLDSRVRSGTQFLHQNDVALYIDWENIKYSLWNKDSRVPNATA
FT                   LKEAASKFGRVVVARAYANWQEHQHQLDPNDLYSAGIEPIYVPTRTYTSTDAVKTNNRR
FT                   KNSVDVKLTVDAVDFCLSNPNIHTFVLVTGDGDFIHLVNALRSRGREVVVIGCSWSTSW
FT                   QLTSMADYFIPYDIEVDPIYDKVGEDNTEDVDLEHAFKTLVEIMHDIRRRGEPNVFAQI
FT                   RLLMLSRMRNFDERHYGFSNFREFMKEAERRGLIKTYNVGLIDRAYLPDEQLEVDVHTH
FT                   MKGIPSNELSASGANTGYASSYPYKEDGRSMLIKLIRYISELERNSPYMSFNFMVENAA
FT                   NNGILPISVSEIATMLNIAIDDGIFKRETKTIYSKATNDYREISVFHLNRSHPLVIEAT
FT                   EEDMVSSES"
     gtgcataact tggatagtcg tgtgcgtagc ggcacacagt ttttacacca aaatgatgta        60
     gctctttaca tagactggga gaacatcaaa tatagccttt ggaacaagga ttcaagggtc       120
     ccgaatgcta cagctctcaa agaagcagct tcaaagtttg gacgtgtagt cgtagccagg       180
     gcttatgcca attggcagga gcaccagcac cagcttgatc ctaatgatct ttattcagct       240
     ggaatagaac ctatctatgt acctaccagg acatacacct caaccgacgc tgtaaagact       300
     aataatcgca gaaagaacag tgtagatgta aagctgacag tggatgctgt ggacttctgc       360
     ttgagtaatc ctaatataca tacatttgta ctagtgactg gtgatggtga tttcatccat       420
     ctcgtcaatg ctctcaggtc gcgcggtaga gaggtagtgg taattggctg ctcctggagc       480
     actagttggc agctcacaag catggcagac tactttatac catacgatat agaggtcgac       540
     cctatatacg acaaggtcgg tgaggataac actgaggacg tagacctgga acatgcattt       600
     aagaccttag tagagataat gcatgatata cgcaggaggg gtgagccaaa cgtcttcgct       660
     cagattcgtc ttcttatgct ctccaggatg cgaaacttcg atgagaggca ctatggattc       720
     tctaacttca gagaattcat gaaagaagct gagaggagag gcttgatcaa gacctacaat       780
     gtgggtctaa tagatcgtgc ttaccttccg gatgagcagc tggaagttga tgtgcatacc       840
     cacatgaaag gtattcccag caatgagcta tctgctagcg gagctaatac tggatatgcc       900
     tcttcctatc cgtataagga agatggcaga agcatgctca tcaagctaat aaggtacatc       960
     agtgagctgg agcgaaacag tccctatatg agcttcaact tcatggtgga gaatgccgcg      1020
     aacaatggaa tactacctat aagcgtttca gagatagcta ctatgctcaa catagctata      1080
     gatgatggta tattcaagcg cgagaccaag accatctaca gcaaagctac gaatgattac      1140
     cgggaaataa gtgtgttcca tctcaacaga tcacatcccc tggttataga ggcaaccgaa      1200
     gaggatatgg tctcgagcga gagctga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page