(data stored in ACNUC7421 zone)

EMBL: CP001825.PE301

CP001825.PE301       Location/Qualifiers
FT   CDS_pept        324891..325889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0303"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sfu:Sfum_0829 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41225"
FT                   /db_xref="GOA:D1CE69"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE69"
FT                   /inference="protein motif:TFAM:TIGR02822"
FT                   /protein_id="ACZ41225.1"
FT                   /translation="MKAQMLSEQLSIDRRPLKLVEVDEPSIGQKDLLIKVKACGVCHTD
FT                   LHIVEGDIPLHKRPIVPGHQIVGVVEKVGEAVTRFSPGDRVGVPWLNWACGRCEYCQRG
FT                   YENLCVNGKFTGWDVDGGYAEYQVTSEDFTYHIPDGYSDLQAAPLLCAGVVGYRALKLA
FT                   KADNAERVGLYGFGASAHIAIQVLRYWGTRVFVFTRSREHQKLALELGAEWAGTANDDP
FT                   GVLMQSSIIYAPAGDIIPQALGVLDKGGVLSLAGIYMTPIPQLDYELLRGEKVIVNVTN
FT                   ATRQDAIELLDLAPRVPIRTEIEVYPLEEANDVLLRLKESKINGSAVLQIS"
     atgaaggcac aaatgctttc cgagcagtta tcaatcgata gacgcccact taaacttgta        60
     gaggtggacg aaccttctat tggccaaaaa gatctgctta taaaagtcaa ggcgtgtgga       120
     gtatgccata ctgatctcca tatagttgaa ggtgatatac ctttgcacaa gcggccaatt       180
     gtacccggcc atcagatagt aggtgtggtg gagaaagtag gtgaggctgt cacacgcttc       240
     tcccctggag atcgagtagg ggtaccctgg cttaactggg catgtggtag atgtgagtac       300
     tgccagagag gatatgagaa tctctgcgtg aacggcaagt tcactggttg ggatgttgac       360
     ggcggctatg ctgagtatca agtcacaagt gaagacttta catatcatat ccctgatgga       420
     tattcagacc tgcaagctgc tcccctacta tgtgctggag ttgtgggtta cagggctcta       480
     aagcttgcta aggctgataa tgctgagcga gtgggcctat atggttttgg ggcttctgct       540
     catatcgcca tacaggtgct aaggtattgg ggaacgaggg tctttgtctt tacccgtagt       600
     agagaacacc aaaagcttgc cctggagctg ggtgccgaat gggcaggtac tgctaatgat       660
     gatcctggag tgttgatgca gtcgtccata atttatgccc cggcaggtga tatcattccg       720
     caggcccttg gagtgctgga taaaggtggg gttctgtctc tagcaggtat atatatgaca       780
     cctatacctc aattagatta tgagctgctg cgcggagaga aagttatagt gaatgttaca       840
     aatgcaacca ggcaagacgc tatagagctt ctggaccttg cacctagggt gccgatacgt       900
     accgagatag aggtatatcc tctagaagaa gccaacgatg tgctattaag actcaaggaa       960
     agcaagataa acggttcagc tgttttacag atatcataa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page