(data stored in ACNUC7421 zone)

EMBL: CP001825.PE305

CP001825.PE305       Location/Qualifiers
FT   CDS_pept        complement(328305..329228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0307"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification glutaminyl transferase-like protein"
FT                   /note="KEGG: sus:Acid_3927 glutathione synthase/ribosomal
FT                   protein S6 modification glutaminyl transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41229"
FT                   /db_xref="GOA:D1CE73"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE73"
FT                   /inference="similar to AA sequence:KEGG:Acid_3927"
FT                   /protein_id="ACZ41229.1"
FT                   /translation="MEKLRVGLLVGREKSLVSALLQEITSNYSHVDVGIARLGAVELGE
FT                   DCRYSVIVDRLSHVVPFYKAYLKHALVSGVYVINNPFVSSSDDKFHQVSLAHKLGLLTP
FT                   KTVLLPNHYFLENYSPSRELVSHPLPVDWYEVAEEVGLPCILKDAEKGEWSELHICHSV
FT                   DELMENYRHTSTRTVMVQELIDWDLFVRCLVIGEEVIPMYFDFQKKRYLPGSQGIPNEL
FT                   EESIMSDSSKIVKELGYDINLVEWAVYEDKAFLIDCFNPIPDIDPDAMEESDFKWAIKA
FT                   LAELLNQLTIKIANGEAIYRNPKLGS"
     atggaaaaac taagagtggg acttctggta ggaagagaga aaagtctagt cagtgcactt        60
     ttacaggaga ttacatccaa ctattcacac gtagacgtgg gaatcgccag gctaggagca       120
     gtagagctgg gagaagactg cagatattcc gttattgttg acaggctttc gcacgtcgtt       180
     ccattttaca aggcctacct caagcacgcc ttagtaagcg gtgtctatgt tatcaacaac       240
     ccgtttgtat cttcctcaga tgataagttt catcaggtat ctctggctca taaactaggt       300
     ctactaacac ccaaaactgt gctactaccc aatcactact ttctagaaaa ttattctcct       360
     tctcgagagc tagtaagcca tccgctacca gttgactggt acgaggtagc agaagaagta       420
     ggactaccct gcatattgaa ggacgcagaa aaaggtgagt ggtctgagct acatatatgc       480
     cactcagtag acgagcttat ggaaaactac cgacatacat cgacaagaac agttatggta       540
     caagaactca tagactggga tctttttgtt cgttgcctgg ttataggaga ggaagttata       600
     cctatgtact ttgacttcca gaagaagaga tatctacccg gcagtcaagg aatacccaac       660
     gagctcgaag aaagcattat gtcggactca tctaagatag tcaaagaact tggctacgat       720
     ataaacttgg tggaatgggc tgtatatgag gacaaggcct ttcttataga ttgcttcaac       780
     ccaataccag acatcgatcc tgatgctatg gaagagtcag attttaagtg ggctatcaag       840
     gcacttgctg agctcctaaa tcagctaact ataaagatag ctaatggaga ggctatctac       900
     aggaacccaa agctaggatc ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page