(data stored in ACNUC7421 zone)

EMBL: CP001825.PE308

CP001825.PE308       Location/Qualifiers
FT   CDS_pept        334633..335244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0310"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcr:BCAH187_A2132 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41232"
FT                   /db_xref="GOA:D1CE76"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE76"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41232.1"
FT                   /translation="MKQEDKSHILLRIPERISTRRLVIRNYVPEDATSLWLAVEESRES
FT                   IEPWLRWPRDVRNVDTARIRIRYLQAEWILRDRLVWGLFSKEDQQLFGEIGLVHPDWSV
FT                   VSFQVSYWLRKSAQGHGYMREALRAITALVFETISASRVEVRVESDNLRSRKVPEALGY
FT                   RLEGVLRRDHVGLDGELTDMYVYALTSEDYEDIRLGSEDQ"
     atgaaacagg aagataagag tcatatctta ctcaggatac cggaacgtat atctactcgt        60
     aggctggtga ttaggaacta cgtgcccgag gatgccacat ctttatggtt agcagtggaa       120
     gagtcgagag aatcgattga gccatggcta cgatggccta gagatgtaag aaacgttgat       180
     acggcaagaa tcagaattcg ctacctacaa gccgagtgga tactcaggga taggctggtt       240
     tggggattat tcagcaaaga ggatcagcaa ctctttgggg agataggact tgttcatcct       300
     gactggagtg ttgtgagctt ccaagtatct tattggctga gaaaaagtgc tcaggggcat       360
     ggttacatgc gggaagcact cagagctatt acagctctgg ttttcgaaac cataagtgcc       420
     agtagagttg aggtaagggt agaatctgat aacttgagaa gcagaaaagt ccccgaggcg       480
     ttaggataca gacttgaagg cgtgcttaga agagatcacg taggactgga cggtgaactc       540
     acagacatgt atgtatatgc attgacttct gaggactatg aagatattag attgggcagt       600
     gaagatcaat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page