(data stored in ACNUC7421 zone)

EMBL: CP001825.PE31

CP001825.PE31        Location/Qualifiers
FT   CDS_pept        complement(32238..34319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU04320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40955"
FT                   /db_xref="GOA:D1CDE9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE9"
FT                   /inference="similar to AA sequence:KEGG:BSU04320"
FT                   /protein_id="ACZ40955.1"
FT                   /translation="MTNGHDPSSELDVKEVRRGRHPGDRYVRVQHTPGFQKVGRGYISV
FT                   TPRATEPKTFVGKALRSVRRFLIGSPIETAREVHERLTKIKALAILGSDNISSSSYATE
FT                   EIMRILLLGGISALSLTLPITLAVICVLIIVVISYQQTIRAYPHGASAYIVASNELGKL
FT                   PGLTAAASLLNDYVLTVSVSIAAGVAALGSAAPFFLGSSAGDFFYNHRVLVSIVLIMII
FT                   MIGNLRGVREAGTIFAAPTYIYIISILGLLAYGFYRFASGDLPEYNPPPGWVEEWQHRS
FT                   LGALSILLILRAFASGSVGLSGTEAISDGVPAFKPPEWKNARITLIFMAGTFGILFLGI
FT                   SFLSGQLHIIPAPEEQETVLSQLARTLVGTGPYYLLVQAATAVVLVLAANTAFSDFPRL
FT                   AYFLARDGYMPHQFLHRGDRLAFSVGIISLSVIASLLLIIFGGSVTALIPLYTVGVFVA
FT                   FTLSQSGMVAHWRRQRGKGWRVKAAVNGVGATITGIVAVIVAVTKFSSGVPLFNIGSFT
FT                   VHAGSWIVLVLVPLMILMLMSIRSHYERAQRELQPEIPINPSDIKHTIIVPVASLNKVA
FT                   LQSLAYAKSISPNVTAIHVVENQEEAEEFRKEWEKFGSPCSLVIMESPYRSLVGPILAY
FT                   IDAVDRKRPDDTITVVLPEFVPKHWWERLLHNQTALRLKAALLFRPGTVVINVPYHLK"
     atgactaacg gtcatgatcc cagctcagag ttagatgtaa aggaagtcag gcgtggtagg        60
     catccgggtg ataggtatgt aagagtccag catactccgg gatttcaaaa agttggccgt       120
     ggatatatat cggttactcc cagagcaact gaacccaaga ctttcgttgg caaggcacta       180
     aggagtgtta gaaggtttct aattggttca ccaatagaga ccgcaaggga agttcacgaa       240
     cgccttacga agataaaggc actggctatc ctgggttcgg ataatatctc ctcctcatcg       300
     tatgctactg aagaaatcat gaggattcta ttgctggggg ggatatctgc gttatctcta       360
     accctaccta taacattagc ggttatatgt gtcctcataa tagtcgtcat ctcctaccaa       420
     cagacaataa gggcctatcc tcatggcgct agtgcctaca tagtagcatc caacgagtta       480
     ggtaagcttc ctggactgac agcagcagca tctcttctca acgattatgt gcttacggtt       540
     tcagtatcta ttgctgctgg tgtggctgcc ttagggtctg cggctccgtt cttcctggga       600
     tcaagcgctg gtgacttctt ctataaccac agagtgcttg tatcaattgt gttgataatg       660
     atcatcatga taggcaatct acggggagtc cgagaggccg ggacgatttt tgcagctcct       720
     acttatatct atataatctc tatcctcggt cttttagctt atggctttta tagatttgcc       780
     agtggtgacc ttcctgagta taacccgcct cctggctggg tggaggaatg gcagcataga       840
     tctctaggag cactgagtat attgctaata ctgagggctt tcgcttcagg ttctgtgggt       900
     ctaagcggta ctgaagccat ttcggacggt gtgccagcct tcaaaccgcc tgaatggaaa       960
     aatgctagga taaccctcat attcatggca ggaactttcg gaatactatt cctaggtata      1020
     agcttccttt cgggtcaact gcacataatt cctgctcctg aggaacaaga gacagttctc      1080
     agccaactgg ctcgtaccct cgtgggtaca ggtccttatt acttgctagt tcaggcagct      1140
     actgcagtag tactggtgtt ggctgctaat acagctttct ccgatttccc caggttggct      1200
     tatttcctgg cgcgcgatgg ctacatgcct caccagttct tgcatagagg tgatagactg      1260
     gcattttctg tggggataat ttccttgtca gtaatagcgt ccctactgct gataatattt      1320
     ggcggtagcg tgacggctct aattcctctg tatacggttg gtgtgtttgt ggccttcact      1380
     ctttcccaat ctggaatggt tgctcattgg cgcaggcaga gagggaaagg atggagagta      1440
     aaagccgccg taaacggtgt gggtgcaact attactggca tagttgctgt gatagtggct      1500
     gtgaccaagt tctccagtgg tgtccctctg ttcaacatag gcagttttac cgtacatgca      1560
     ggctcttgga tagttctcgt gctcgtacct ctcatgatat taatgctgat gtcaattcgt      1620
     agccattacg agagggcgca gagggagcta caacctgaga tcccaattaa tccatctgat      1680
     atcaagcaca cgatcatagt accggtagcc agcctgaata aagtagctct gcaaagtctt      1740
     gcatatgcta agtctataag cccgaacgtc acagctatac acgtagtgga gaatcaggaa      1800
     gaggcggaag agtttagaaa agaatgggaa aagtttggca gcccatgtag cctggttatc      1860
     atggagtctc cttacaggtc tctcgttggt ccgatattgg cttacataga cgcggtagac      1920
     agaaagagac cagatgatac cataactgta gtactgcccg agttcgtgcc caagcattgg      1980
     tgggaaagat tgctacataa ccagactgca ctcaggttga aagcagcgct gttatttagg      2040
     cctggcacgg tagtaataaa cgtgccttat cacttgaagt aa                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page