(data stored in ACNUC7421 zone)

EMBL: CP001825.PE310

CP001825.PE310       Location/Qualifiers
FT   CDS_pept        complement(335861..336499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0312"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   dds:Ddes_0597 tRNA guanosine-2'-O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41234"
FT                   /db_xref="GOA:D1CE78"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE78"
FT                   /inference="protein motif:PRIAM:2.1.1.34"
FT                   /protein_id="ACZ41234.1"
FT                   /translation="MNTTRKITERRLNRMIQVLKRRQPDLTVVLENVHDPHNVSAVLRS
FT                   CDAVGVLAVHLVYTIEEFPDLSKNVSGSALKWLEIIKHKDIQDCYDTLRSQGMTIYTTY
FT                   LADPQRSHDLYSLDLTKPTALVFGNEQRGVSEEASRLADGNFVIPMMGMVQSLNISVAC
FT                   AVTLYEALRQRRAAGHYDHPKLSREEISTRLHNWLQREKRSIEELQKLI"
     atgaatacta cgagaaagat aacggaacgc agactcaaca gaatgatcca ggttctgaag        60
     agaaggcaac ctgatctaac tgtagtcctc gagaacgttc atgatccaca caacgtgagc       120
     gcagtcttac gcagctgtga tgctgtggga gtactagcag tgcacctggt atacaccata       180
     gaggagtttc cagacctcag caagaacgtt tctggcagcg ctctaaagtg gctagagatt       240
     ataaagcaca aggacatcca agactgttac gacactctca gatctcaagg gatgacgata       300
     tacacaacct acttggcgga tccgcaaaga agccacgacc tgtactctct agatctcact       360
     aagcctaccg ctctagtatt cgggaacgag cagaggggag tctcagagga ggcttcgaga       420
     ctagctgacg gtaactttgt catcccgatg atggggatgg tccaaagcct gaacatctca       480
     gtagcttgtg ctgtgaccct gtacgaggct cttaggcaga gacgtgcagc tggacattat       540
     gatcatccca agctaagtcg ggaagagata tcaacgcggc ttcataactg gcttcaaaga       600
     gaaaaaaggt ctatcgaaga gcttcaaaag ctgatctag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page