(data stored in ACNUC7421 zone)

EMBL: CP001825.PE311

CP001825.PE311       Location/Qualifiers
FT   CDS_pept        336912..338165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0313"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: Os12g0235800; hypothetical protein; K01940
FT                   argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: argininosuccinate synthase; ExsB family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41235"
FT                   /db_xref="GOA:D1CE79"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE79"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACZ41235.1"
FT                   /translation="MALSPLEKIQAVEVPKYRKVALAYSGGLDSALCLVLLREKYGAEE
FT                   IIPITVDVGQGQDEVEQSFKKAEVLGVEPLLIDAKSEFTNEWLTKAIRANSSYNGYPVS
FT                   TSMTRQLIAAKVAQKAVELGCDALAEGSSGKGNDQYRMHKVFKYFAPQLGIIVPVRDFD
FT                   LTRTEEMELCEHYGVPVTEIIVGGDDKTMWCRSIASGGITLETELPDNIWLWYTPPQKA
FT                   PDDPYTFTIEFEAGIPVALNGQKMPLEDIIDQLNVIGGKHGIGKIDMFEDGIMDLKSRE
FT                   IYEAPAATIILTIHRDLEQFTLTKDEIQFKKIVDAQWAYKVYHGEWFHPLKKALDAFIA
FT                   ETQSVVNGEYTVQLYKGNIDILKRKSDTGLFFPDVRSISSASFNQQLCGPTAQIWGLPF
FT                   ELLARREKESKKVGAASE"
     atggctcttt caccgcttga gaagatacag gctgtagagg tccccaagta ccgcaaagtg        60
     gctctggctt attcgggtgg tttggactcg gccctctgcc tggtactcct cagggagaaa       120
     tatggtgccg aggaaattat acctataact gtggatgtag gacagggtca ggacgaggta       180
     gaacagagct tcaagaaggc cgaggtactt ggagtggagc cgctgctcat agacgccaaa       240
     tcagagttca ctaatgagtg gttgaccaag gctatcagag ccaactctag ctataacggt       300
     tatccagtat ctacctccat gaccaggcag cttatagccg ctaaggtggc tcagaaggct       360
     gtagagctag gctgtgatgc tctcgccgag ggttcaagtg gcaagggcaa tgaccagtac       420
     aggatgcata aagtcttcaa gtactttgct ccccagctgg gaataatagt gcccgtgagg       480
     gacttcgacc tcacccgaac agaggagatg gagctttgtg agcactacgg agtgcctgta       540
     accgagatca tcgtgggtgg tgatgataag actatgtggt gccgctccat tgctagcggt       600
     ggaataaccc tcgagaccga gttacctgat aacatctggc tttggtacac accacctcag       660
     aaggctccag atgatcccta caccttcacc attgaattcg aggctggtat cccggtagct       720
     ctcaacggcc aaaagatgcc gcttgaggat ataatcgatc agctcaacgt tatcggtggt       780
     aagcacggta taggtaagat cgatatgttt gaagacggca taatggacct caagtccaga       840
     gagatctatg aggctccagc tgctaccata atactaacga tccatcgcga tcttgagcag       900
     tttacgttga ctaaggacga gatccagttc aagaagatag tggatgctca gtgggcctac       960
     aaggtttatc acggtgagtg gttccacccg ttgaagaagg cgctggatgc atttatagcg      1020
     gagactcaga gcgtggtcaa tggtgaatat accgtgcaac tctacaaggg caacattgat      1080
     atcctgaagc gcaagtccga taccggcttg ttcttcccgg atgtcagatc tatctccagc      1140
     gctagcttca accagcagct ctgtggtcca acagcccaga tctggggtct gccgttcgag      1200
     ctgctagcta gaagggaaaa ggagagcaag aaagtaggag ctgctagtga gtaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page