(data stored in ACNUC7421 zone)

EMBL: CP001825.PE313

CP001825.PE313       Location/Qualifiers
FT   CDS_pept        339527..339703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0315"
FT                   /product="lysine biosynthesis protein LysW"
FT                   /note="TIGRFAM: lysine biosynthesis protein LysW"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41237"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE81"
FT                   /inference="protein motif:TFAM:TIGR01206"
FT                   /protein_id="ACZ41237.1"
FT                   /translation="MAATQTGTCPECEAEIALADVEKGEIVQCPDCGAELEVRDTNPIV
FT                   LELAPEEEEDWGE"
     atggcagcga cccaaacagg cacttgtccc gaatgtgagg ctgagatagc tcttgctgat        60
     gttgagaagg gcgagatagt tcagtgtcct gactgcggag cagagctcga agtacgtgat       120
     acaaacccaa ttgtcctcga gttggctcct gaagaagagg aagactgggg agagtaa          177
//

If you have problems or comments...

PBIL Back to PBIL home page