(data stored in ACNUC7421 zone)

EMBL: CP001825.PE318

CP001825.PE318       Location/Qualifiers
FT   CDS_pept        343645..344439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0320"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: noc:Noc_2995
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41242"
FT                   /db_xref="GOA:D1CE86"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE86"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACZ41242.1"
FT                   /translation="MLVIKIGGSKGINVDKILEDVPNIQDKMVIVHGANYELNQVSEQL
FT                   GHPPRIVTSSTGQVSRFTDRRTMEIFMMVYCGKVNKTIVEKLQRLGVNAVGLSALDGGI
FT                   AKGRRKDQIRVIEDGKPKVLRGDYAGSIQQIDTRLINLLLDNGYLPVLTPPAISHEGEA
FT                   INVDGDKLAMEIAAALHADKFLIFSDTPGLLRNLEDENSLITRVGPDEIEEAMQVAEGR
FT                   AKKKVLAAGEALKRGIGQVIFADGRVDAPIQKALSGIGTVIG"
     atgctggtta tcaagatcgg tggtagcaag gggataaacg tagacaagat cctggaggat        60
     gtccccaata tccaagacaa aatggtcata gtccatggag ctaattacga gctcaatcag       120
     gtctccgagc agctggggca tccccctcgt atagtgacct caagtactgg gcaagttagc       180
     agatttaccg accggcgtac catggagatt ttcatgatgg tctattgcgg aaaggtgaac       240
     aagaccatag ttgaaaagct ccaaagactt ggtgtaaacg cggtcgggct tagtgccctg       300
     gacggaggga tagccaaagg taggcgcaaa gaccagataa gggttattga agatggtaag       360
     ccgaaggtgc taagagggga ttatgctggt agtattcagc agatagatac taggctcata       420
     aacctgctgc tcgacaatgg atatcttccc gtgcttactc cgccagccat atctcacgaa       480
     ggtgaagcaa taaacgttga cggcgataag ctggccatgg agatagcagc cgcattgcat       540
     gctgacaagt ttctaatttt ctccgacaca cccggtttgc tcaggaattt ggaggatgaa       600
     aactccctca taacaagagt ggggcctgat gagatagaag aggccatgca ggttgcagaa       660
     ggtagagcaa agaagaaggt gcttgcagca ggcgaggctt tgaagagagg tataggacaa       720
     gttatattcg cagatggtcg tgtagatgct cctatccaga aggcgctgtc aggtattgga       780
     acagtaatag gctaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page