(data stored in ACNUC7421 zone)

EMBL: CP001825.PE319

CP001825.PE319       Location/Qualifiers
FT   CDS_pept        344453..345628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0321"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   bha:BH2897 acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41243"
FT                   /db_xref="GOA:D1CE87"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR037537"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE87"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACZ41243.1"
FT                   /translation="MDIQQIENETLVPMYAKRDIALVRGEGYYLWDSEGNRYYDFASNY
FT                   GVNILGHSHPAITNAISQQASTLISCHQSFYNDVRAKYLQKLSEKLPEGLDKVFFCNSG
FT                   TESVEAAIKFARAATGRSRIIATKRGYHGRTYGALSATADKKYREPYMPLVPDFEHVPY
FT                   ADLEALERSLSEDVAAVILEPVQGESGIYPAPKEYLAGVRAATRKFGALLILDEVQTGF
FT                   RTGKYFAFEHYDIVPDILCLSKAVANGFPMGLTITSRDVASRLPAGTHGNTFGGNPLAC
FT                   AVALVVLEEIDRGDLLSNAANMGAYLIDRLRSMNSPVVREVRGLGLMIGVELKDRPTKY
FT                   LRLLQERGFIALPAGATTIRFLPPIVIDQQAIDALIEVFEEVLTAQNFVRS"
     atggatatcc agcagataga gaatgaaacc ctggttccca tgtatgccaa gagagatata        60
     gccttggtaa ggggtgaagg ctattaccta tgggattcag aaggtaatag gtattatgat       120
     tttgcatcaa actacggggt caacattctc ggacattctc atcctgctat cacaaacgct       180
     atatctcagc aggcttccac tctgatctca tgtcatcaga gcttttacaa cgatgtgaga       240
     gcaaagtatc tgcagaagct ttcagagaag ctcccggaag gccttgacaa agttttcttc       300
     tgtaactcag gcaccgaatc cgtggaggca gccataaaat ttgctcgggc cgctacaggt       360
     aggagcagga ttatagctac aaaacgcggt tatcatggca gaacatatgg tgctcttagc       420
     gctacagctg acaagaagta tcgagaacct tacatgcctt tggtacccga cttcgagcat       480
     gtaccgtatg cagatttgga agccttggag agaagcctct ccgaagacgt ggctgcggtt       540
     atattagagc ctgtgcaggg ggaatccggt atttatcctg cccccaaaga ataccttgca       600
     ggcgtgaggg ctgccacacg caaattcggt gcactattga tcttagatga ggtacagact       660
     ggcttcagga caggcaagta ctttgctttt gaacattatg acatagtccc tgacatactg       720
     tgcctttcta aggcagtggc caatgggttt ccaatggggc ttaccataac ctccagagat       780
     gtagcttcca ggttacctgc aggcactcat ggtaacacct tcggaggcaa tccattggcc       840
     tgtgcggttg ctttggtagt gctagaagag attgatagag gagatctttt gtccaatgct       900
     gctaatatgg gcgcctattt gatagatagg ctcagatcta tgaactctcc tgtagtacgc       960
     gaggttaggg gcctagggct gatgataggg gtggagctca aggataggcc cacaaagtac      1020
     cttagactgc tacaagaaag gggctttata gctctgcctg cgggcgctac gactatacgt      1080
     tttctgcctc ccatcgtaat tgatcaacaa gccatagatg cccttattga ggtgttcgag      1140
     gaggtactga cggcccagaa ctttgtcaga agctag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page