(data stored in ACNUC7421 zone)

EMBL: CP001825.PE322

CP001825.PE322       Location/Qualifiers
FT   CDS_pept        348346..349557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0324"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: sfu:Sfum_0061 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41246"
FT                   /db_xref="GOA:D1CE90"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE90"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACZ41246.1"
FT                   /translation="MEKIKKVVLAYSGGLDTSVILAWIKENYGAEVIAFTADVGQGEEV
FT                   EEAKQKALATGASKAYALDLREEFVRDFVFPVIRAAAVYENQYLMGTSIARPLIARELV
FT                   RIAREEGADAIAHGATGKGNDQVRFELTAYALQPDIKVIAPWREWSFKGRTDLINYAKE
FT                   KGIPVPVTPERPYSIDANLFHISYEGGVLEDPWVAPPKGMWRLTRDPEDAPDVPEEIEI
FT                   EFEAGNPVAVNGQRMGPLELLQCLNQIAGKHGVGRVDIVENRFVGMKSRGCYETPGGTL
FT                   LHIAHRAVESITLDREVMHLRDQLIPQYAEMVYNGFWYAPERIALQKFMDDIQQRVSGV
FT                   ARLKLYKGNAYVTGRKSDASLYDHKTVTFEEDEVYNQADAGGFIRLQALRLRTHAAKRL
FT                   GPGE"
     atggagaaga tcaagaaagt agtactggca tattctggag ggctagatac ttccgtcata        60
     cttgcgtgga taaaagagaa ctacggagca gaagtaattg cttttaccgc tgatgttggg       120
     cagggagaag aggtagaaga ggccaaacag aaggctctgg ccactggtgc ttctaaggcc       180
     tatgcgctgg atctacgcga agagttcgtc agagacttcg ttttccctgt cataagagcg       240
     gcagccgtct acgagaacca atatctaatg ggtacatcga tagccagacc tcttatagct       300
     agagaactag taagaattgc tcgagaagaa ggagccgatg caatagccca tggtgcaact       360
     ggtaagggta atgatcaggt aagattcgaa cttacagcat acgccctgca gcctgatata       420
     aaagtcattg ctccatggag ggagtggagt tttaaaggca ggaccgatct aatcaattac       480
     gccaaggaaa agggtattcc ggttccggtt actccggaga ggccttactc tatagatgct       540
     aatctgtttc atataagcta tgaaggtggt gtactggagg atccatgggt agcaccgcca       600
     aagggtatgt ggcgacttac acgcgatcct gaagacgccc cggatgttcc tgaggagata       660
     gagattgaat tcgaagcagg taatcctgta gcagtgaacg gccagaggat ggggccgcta       720
     gagttactac agtgtctcaa tcagatagct ggtaagcatg gcgtaggcag agtggatatc       780
     gtcgagaaca gattcgttgg tatgaagtct aggggatgtt atgagactcc tgggggaaca       840
     ttgctacaca ttgctcatcg agctgtcgag tctataactc ttgacaggga ggtgatgcac       900
     ctcagggatc aactcatacc tcagtacgct gagatggtgt ataacggctt ctggtatgct       960
     ccagaaagga tcgccctaca gaagttcatg gatgatattc agcagcgagt tagtggtgtt      1020
     gccagactta agctatacaa gggtaatgct tacgtgacgg gcagaaaatc ggatgcttct      1080
     ctatacgatc acaagactgt tactttcgaa gaggatgaag tgtataacca ggccgatgct      1140
     ggaggtttca tacggctcca ggctttgagg ctgagaacac acgcagctaa gaggctaggg      1200
     ccaggagaat aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page