(data stored in ACNUC7421 zone)

EMBL: CP001825.PE323

CP001825.PE323       Location/Qualifiers
FT   CDS_pept        349604..350734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0325"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="KEGG: ade:Adeh_1294 dihydroorotate oxidase A;
FT                   TIGRFAM: dihydroorotate dehydrogenase; PFAM: dihydroorotate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41247"
FT                   /db_xref="GOA:D1CE91"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE91"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ACZ41247.1"
FT                   /translation="MATGIYKHLVLPLLDRLDSETWHERVRHGLHTVEQVPLGPEFLEI
FT                   LAWKGRRVVDPRLKVSLAGVQLENPLIVGAGWDKSGISIRALYALGFASVEVGTVTPRP
FT                   QPGNPRPRQFVLSSGVVINRLGFNNPGADAVAANLESYKSDNIPVGISIGKNKDDPEDR
FT                   APLAYAEVARKLYPYGSYFVINVSSPNTPGLRSLQRKEALLSIAQSVLDVMDSYGARKP
FT                   LFIKIAPELSYQEVDEILDVVLQLGLAGVVATNTVALGDVKARYGEGWRLQPGGLSGDD
FT                   EVFRHMSTSKVAYIYSQTKGSIDIIGVGGVKDAHTALEKILAGATAVQVVTAIRSEGLA
FT                   VAARTNLGLLEWLDKNGVKSISNVVGARYEDFLDTK"
     ttggctactg gtatatataa gcacttagta ctacccttgc tagatagact ggactccgaa        60
     acttggcacg aaagggtaag gcacggtcta cataccgtgg aacaagtgcc tttggggccc       120
     gagttccttg agatcttggc ctggaagggt agacgtgtag tagatccaag gctaaaagtt       180
     agcttggctg gtgtgcaact cgaaaacccc ttaatagtgg gggcaggctg ggataaatct       240
     ggtatatcaa taagagctct atatgcgctc ggtttcgcaa gcgttgaggt gggcaccgta       300
     actcctagac cgcaaccagg caatcctagg cccaggcagt ttgtacttag ctctggtgtg       360
     gtgataaaca gactaggatt caataaccct ggagctgatg cggttgcggc taatttggag       420
     tcatataaat ccgacaacat accagtgggt ataagtatag ggaagaataa agatgatccc       480
     gaggacaggg ctccattagc ctatgctgaa gttgctagga agctgtatcc ttacggctcc       540
     tacttcgtaa ttaatgtctc atcccctaac actccaggtc tccggtcact ccagcgaaag       600
     gaggctctac tatctatagc tcagtcagtg ctagatgtca tggacagtta tggagctaga       660
     aaacctttat ttatcaaaat agcgccggaa ctctcttacc aggaagtgga tgaaatcctg       720
     gatgtagtat tacagttagg gcttgctggg gtggtagcaa ccaatactgt ggcgttggga       780
     gatgtcaagg ctagatatgg agaggggtgg agactacagc caggtgggct cagtggggat       840
     gacgaagtgt tcaggcatat gtccacatcc aaggtggcat atatatattc ccaaaccaag       900
     gggagtatag acataattgg cgtgggggga gtcaaggatg ctcacactgc gttggagaag       960
     atccttgccg gagctacggc cgtacaggta gtgactgcta tccgcagtga ggggcttgca      1020
     gtagcagcga ggactaacct ggggcttcta gaatggttgg ataagaacgg tgtaaagtcg      1080
     ataagtaacg tggttggagc tagatacgaa gattttctag ataccaagta a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page