(data stored in ACNUC7421 zone)

EMBL: CP001825.PE325

CP001825.PE325       Location/Qualifiers
FT   CDS_pept        complement(351114..353309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0327"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: rce:RC1_0515 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41249"
FT                   /db_xref="GOA:D1CE93"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE93"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACZ41249.1"
FT                   /translation="MQIEGACRIEDLINGTCYDPHSILGMHPVERNGRRCIELRVWVPG
FT                   AIKVSALDYKTNEEILPLERVHEAGFFIGTFPTRTEVFPYRLRISTAHHTWVQEDPYRF
FT                   LPTIGELDLYYIGEGTHRKLYEVLGAHLREIDGVKGVSFAVWAPNARGVSVIGDFNGWD
FT                   KRRYPMRVLGSSGVWEIFLPGVQVGEKYKYAINGADGIEREKADPLAFYSELRPRTASI
FT                   IYDLSGYKWKDREWMLRRLENNPYKKPMNIYEVHLGSWKRHPDGSWLSYRELADELVPY
FT                   VKRMGFNYVEFMPLLEHPYDGSWGYQVTGFYSATSRFGTPDDLRYLIDRCHQAGIGVII
FT                   DWVPAHFAVDEHGLCRFDGTYLYEHEDIRRRFQPDWGTFSFNYGRNEVRNFLTASALFW
FT                   VKEFHVDGLRVDGVSSMLYLDYSRGPGEWTPNKYGGRENLEAIDFLREMNSLVYAEGEG
FT                   AITIAEESTAWPGVSRPVYLGGLGFGFKWNMGWMHDTLEYFRKDPIYRKYHHNDLTFSM
FT                   VYAYNENFILSLSHDEVVHGKGSLVNKMPGDEWQQFANLRLLFAYQWAHPGKKLIFMGD
FT                   EFGQRSEWNHDWQLDWWVLQFGYHQGVQRLLQDLNRLYLHEPALYRLDHDPKGFTWLDY
FT                   SDWENSVISFARWSGDGNNHIVCAFNFTPVPRYNYRIPAPHLGKYREVLNTDAQIYGGS
FT                   GIGNMGEVSSEVVMHNGHPYSVAITLPPLGAVFFKPM"
     atgcaaatag aaggcgcatg caggatagag gatctcataa atggcacgtg ttatgatcca        60
     cactccatac ttggaatgca cccggtcgag aggaacggta ggagatgcat agagctgaga       120
     gtctgggtac cgggagccat aaaagtatca gccctcgatt acaaaacaaa cgaagagata       180
     ctaccccttg aaagggtaca tgaagccggc ttcttcattg gtacttttcc taccaggaca       240
     gaggtcttcc cctatagact acgcatttca acagcacatc acacttgggt gcaagaggac       300
     ccataccgct ttctgccgac tataggagag ctagatctat actacatagg agaaggtacc       360
     cacagaaagc tgtacgaggt actgggagcc catcttagag agatagatgg agtcaagggt       420
     gtctcttttg cagtgtgggc accaaatgct cgtggcgtca gtgttatagg ggatttcaac       480
     ggttgggata aacgcagata cccaatgaga gtgcttgggt catcaggcgt ctgggagatc       540
     tttctcccag gagtccaggt tggagagaaa tacaagtacg ctataaatgg cgccgatggc       600
     atagagaggg aaaaggctga tccactggca ttctacagcg agttaaggcc aaggacagca       660
     tccatcatat atgacttgag cggttacaaa tggaaagaca gagaatggat gctaagacgc       720
     cttgaaaaca atccatacaa aaagcccatg aacatttacg aggttcacct cggctcatgg       780
     aagcgtcatc cggatggctc atggctctct tatagagagc ttgcagatga actggtaccc       840
     tatgtcaaaa gaatgggatt caactacgtg gagtttatgc ccctactgga acatccctat       900
     gacggatcat ggggttacca ggtaactgga ttctattcgg caactagcag gtttggtaca       960
     cctgatgatc tcagatatct aattgacaga tgtcaccagg caggcatagg tgtgatcata      1020
     gactgggtac ctgcacactt tgcagtagac gaacatggcc tttgtagatt cgacggaact      1080
     tatctgtacg aacatgagga tatcaggcgg agattccaac ctgactgggg gactttttct      1140
     ttcaattatg ggagaaacga agttcgtaac tttctaacag ctagcgccct attctgggtc      1200
     aaggaatttc acgtcgatgg cctccgagtt gatggcgtaa gctctatgct ttacctcgat      1260
     tacagcagag gtcctgggga atggacgccc aataagtatg gtggtagaga gaatttagaa      1320
     gccatagatt tcttacgtga aatgaactct ctcgtatatg cggaaggcga aggagccatc      1380
     accatagcag aagaatctac agcctggcca ggtgtatcta gacccgttta cctggggggg      1440
     ctgggctttg gcttcaagtg gaatatggga tggatgcatg atactctaga gtactttcgt      1500
     aaggatccca tatatcgtaa atatcatcat aacgatttga ctttctctat ggtgtacgca      1560
     tacaacgaga actttattct ctcccttagt cacgacgagg tcgttcatgg caagggttcc      1620
     ttagtcaaca agatgcctgg tgatgagtgg cagcagttcg ctaatcttag actactcttt      1680
     gcctaccaat gggcccaccc cggtaagaag ctcatattca tgggagacga gttcgggcag      1740
     agatctgaat ggaatcatga ctggcagctg gattggtggg tactgcagtt cggctatcac      1800
     cagggagtgc aaagattgct gcaggactta aacagattat atttgcacga accagcacta      1860
     tatagactcg accatgatcc caagggtttt acctggctcg attactccga ctgggagaac      1920
     tcggtgatat cttttgcacg atggtctggc gatggtaaca atcacatagt atgtgctttc      1980
     aactttacac ccgtgcctag atataactac aggatcccag cacctcatct aggtaagtac      2040
     cgagaagtgc tgaatacgga tgcccaaatt tatggtggta gtgggatagg gaatatgggt      2100
     gaagtaagct cagaggtggt catgcataat gggcaccctt attccgtagc tataacactt      2160
     ccgcccttgg gggcagtctt ctttaagccc atgtaa                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page