(data stored in ACNUC7421 zone)

EMBL: CP001825.PE329

CP001825.PE329       Location/Qualifiers
FT   CDS_pept        complement(358585..360543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0331"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: alpha amylase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41253"
FT                   /db_xref="GOA:D1CE97"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE97"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACZ41253.1"
FT                   /translation="MADQQPDPFYRISIVSVRPQIDCGRFPIKRIVGDRLRVTADIIKE
FT                   GHDTLGAEVRYRRQGSEEWESVPMSYSYDDDEWSAEIPIEFIGMLEYTVAAWTEVFISW
FT                   THELSRKVAAGRDVSSELLEGLELIRQAEARAVGEPKVLLAGYINRLQEASTQREKVDL
FT                   ALTPELAQLVSSHEAREDLTLYNKWLRVIVDREKARFGAWYEMFPRSQTDDPHKHGTFR
FT                   TAMKRLEAIKDMGFDVLYLPPIHPIGFTNRKGRNNALVAQPGDPGSPWAIGNQYGGHDA
FT                   VNPELGTIEDFDAFVREAQNLGIEVALDLAIQCSPDHPYVREHPEWFRKRPDGTIKYAE
FT                   NPPKKYEDIVALDMWCEDFLSLWNELKRVVLFWIEHGIRIFRVDNPHTKPVAFWEWLIS
FT                   EIKREHPDVIFLSEAFTRPKKLQLLAKIGFSQSYTYFTWRNSRWEIEQFMHELLHTEQV
FT                   EFLRPNFFANTPDILTEYLQKGGRPAFKIRLALAATLSPTYGIYSGFELIENVPLHPGS
FT                   EEYLNSEKYEIRVRDWNAPGNIIPYIKTINQARKQNRALQLYTNLTFHYPDNPNIIAYS
FT                   KISEDGSNRILVIANLDPFNWHECTVHLNGEALHIAPWDTYTVHDLITDAYYQWHGTAN
FT                   YVRLDPNYEPVHLFRIE"
     atggcagatc aacaaccaga tcccttctat cgaataagta tagtatctgt aaggccacag        60
     atagattgcg gtagattccc tataaaacgc atagttggcg acagactaag ggtaactgct       120
     gacatcataa aagagggcca tgataccctt ggagccgagg ttagataccg gcgacagggc       180
     tcagaagaat gggaatctgt ccccatgtcg tactcttacg atgacgacga atggtcagcg       240
     gaaatcccta tcgaattcat agggatgctg gagtatacgg tagccgcatg gacagaagtc       300
     ttcataagtt ggactcatga gctgagccga aaggttgcgg ccggcaggga tgtgagctcg       360
     gagctccttg aaggacttga gctaatacgc caggcagagg ctagagctgt gggagaaccc       420
     aaggtgctgc tggcaggata catcaacagg ttgcaggaag cttcaactca gagggagaaa       480
     gtagatctag ctcttacgcc ggagcttgca caacttgtat catcacacga agctagagaa       540
     gatctcactc tgtacaataa gtggctcagg gttatagtcg atagagaaaa ggccaggttc       600
     ggggcatggt acgagatgtt tcccaggtcc caaacagacg atcctcacaa gcacgggacc       660
     tttagaactg ccatgaagag gctagaggct atcaaggata tggggttcga tgtgctctac       720
     cttcctccca tacaccccat tggttttact aaccgtaaag ggcgtaataa cgctctagtg       780
     gcccaacctg gtgaccctgg tagtccatgg gctataggga atcaatacgg cggacatgat       840
     gctgtaaatc ccgaactggg cacaatcgaa gactttgatg cttttgtaag agaagcccaa       900
     aatctaggaa tagaggtagc gcttgatctg gcgatacagt gttctccaga tcatccatat       960
     gtgagggaac acccggaatg gtttcgcaag aggccggatg gcactataaa gtacgccgaa      1020
     aatcctccca agaagtatga agatatagtt gctctcgata tgtggtgcga agatttcctt      1080
     agcctatgga acgaactcaa gcgtgtggta cttttctgga tcgagcacgg catacgcatc      1140
     ttcagggtag ataaccccca taccaagccg gtagccttct gggaatggct tatatccgag      1200
     ataaaaagag aacatccaga cgtgatattc ctctcggaag catttaccag acctaagaag      1260
     cttcagctac tagctaagat agggttctcc cagtcataca cctatttcac atggcgcaat      1320
     agtaggtggg agatagagca gttcatgcat gagctgctac atactgaaca ggtggagttc      1380
     ctaaggccca acttcttcgc taatacacct gacattctca cagaatacct gcagaaagga      1440
     ggcagaccgg cattcaagat aagactggcc ttggccgcaa cgctgtctcc tacctatggt      1500
     atctacagcg gcttcgagct tatagagaac gtgcccttac atccaggcag cgaagagtac      1560
     ctaaactctg agaaatacga gatcagagtc agggattgga acgctccagg gaacataatc      1620
     ccatacataa agacgataaa ccaagctaga aaacagaacc gtgcactaca gctatacact      1680
     aatctaacgt ttcactaccc tgacaaccca aacatcattg cttacagcaa gataagtgag      1740
     gacggcagca accgtatcct ggtgatagct aaccttgatc catttaactg gcatgaatgc      1800
     acggtacatc tcaatggtga agctcttcac atcgcacctt gggatactta tactgtgcac      1860
     gatctaatca ctgatgccta ctaccaatgg cacggcacgg ctaattacgt tcgtctagat      1920
     ccaaactatg aaccagtaca tctctttagg atagagtga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page