(data stored in ACNUC7421 zone)

EMBL: CP001825.PE330

CP001825.PE330       Location/Qualifiers
FT   CDS_pept        complement(360764..362014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0332"
FT                   /product="2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: catalytic
FT                   domain of components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain- containing protein; E3
FT                   binding domain protein; KEGG: mxa:MXAN_6036 2-oxoglutarate
FT                   dehydrogenase, E2 component, dihydrolipoamide
FT                   succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41254"
FT                   /db_xref="GOA:D1CE98"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE98"
FT                   /inference="protein motif:TFAM:TIGR01347"
FT                   /protein_id="ACZ41254.1"
FT                   /translation="MAVEIRVPDLGESVVDVTVLKWHKQPGDSVEEGDVVVELETDKAN
FT                   VEVPAPSSGFLESISIQEGESASVGDLLGTITETPSQAREPSQPEAPQEREAVSPQAAH
FT                   HTEVQPKATPSVRRLAEELGIDISKIEGSGAGGRITREDVLAMRQAPSGAQQAESSKTV
FT                   EAQPIKETTPAPSEAPARELSELERRERMSTRRRVIARRLVEAQHTAAMLTTFNECDMS
FT                   NVIEIRRRLGPRFQEKYGVKLGFMSFFTKAVVAALKEFPYLNAEIDGEDIILKYHYDIG
FT                   IAVGAKEGLVVPVIRNADRKSFAEIEKEIDELATKVRNNTISLEEVRGGTFTITNGGIY
FT                   GSLLSTPILNPPQVGILGMHAIKERPVVVEGQVVVRPMMYLALTYDHRIVDGSDAVRFL
FT                   VRIKELIEDPTSLMLES"
     atggcagttg agatcagagt gcctgatctt ggagaatccg tagtcgatgt tacagttcta        60
     aagtggcata aacaaccagg agacagcgta gaagaagggg atgtagtcgt tgagcttgaa       120
     acagacaagg ccaacgtaga ggttccagct ccttcgagcg gattcctgga gagtatctct       180
     atacaggaag gagaatctgc ctccgtaggt gatctgcttg gaacaatcac ggaaacccct       240
     tcacaggcca gggaaccatc acaacctgag gctcctcaag agagggaagc agtcagccct       300
     caggctgcgc atcatacaga ggtacaaccc aaggcaacac cttctgtacg cagactggcc       360
     gaagagttag gtatagacat ctcaaagata gagggatctg gagcgggcgg cagaatcaca       420
     cgggaagatg tgctagctat gaggcaagct ccgtccggag cgcaacaggc ggaatcaagt       480
     aaaactgtag aagctcagcc cattaaggaa accacccctg ccccctcaga agcccctgca       540
     agggagctat cagagctgga gagacgagag cgcatgtcta ctcgtcgtag agttatagcc       600
     cgtcgattgg tagaagctca gcatacagcc gctatgctta ctaccttcaa cgaatgtgat       660
     atgagcaacg ttatcgagat acgccgaagg ctgggtccca ggtttcagga aaagtatggc       720
     gtcaagctcg gcttcatgtc gttcttcacg aaagcagtag ttgccgctct caaggagttc       780
     ccttatctca acgctgagat agatggcgaa gacataattc tgaaatacca ctacgatata       840
     ggcatagccg ttggcgccaa agaaggatta gtggtgcctg tgattagaaa cgcagaccgc       900
     aagagcttcg cagagataga aaaggagata gatgagcttg ctaccaaggt aagaaataac       960
     actatatctt tggaagaggt acgtggagga accttcacta taaccaacgg aggtatttat      1020
     ggttccctgc tatcaacccc catactaaat cctccacaag taggtatcct cggaatgcac      1080
     gcaatcaagg aaaggccggt tgtggtggaa ggacaagtag tggttcggcc tatgatgtac      1140
     ctagctctta cttatgatca caggatagta gatggaagtg atgcggtgcg cttcctcgtg      1200
     cgtatcaagg agctaataga agaccctact tctctcatgc tcgagagcta g               1251
//

If you have problems or comments...

PBIL Back to PBIL home page