(data stored in ACNUC7421 zone)

EMBL: CP001825.PE332

CP001825.PE332       Location/Qualifiers
FT   CDS_pept        365078..366901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0334"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; KEGG: glo:Glov_1076 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41256"
FT                   /db_xref="GOA:D1CEA0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA0"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACZ41256.1"
FT                   /translation="MSLAEDIKAIPVGKTPEVINDFSIVAATVNGSGSQTSNLTLIRAL
FT                   FRMGIPVNGKNLFPSNISGLPTWYTIRVNKDGYIARKERAEILVAFNPQTAAEDIQALP
FT                   PGGVCIYPAESKLPLVRDDIVYYSVPVKPFVEATGADPKLREKFASMVYVGALAELLGI
FT                   DRQEIRAALSQQFRGKEKVVDQNFQVIVSAADWVKENITKKDPYRVERMEATRGKILID
FT                   GNSAAALGAIFGGVTVAAWYPITPSTSLIEALQSYLPKLRTDKDGNHTYAVVQAEDEMA
FT                   ALGIVLGAGWAGARAMTSTSGPGISLMTEFAGLGFFAEIPGVIWDIQRIGPSTGLPTRV
FT                   SQGDVLKVYFLGHGDTRHVCLIPGTVAECFEFGYKAFDLAERLQTPVFVLSDLDLGMNL
FT                   WMSDPFEYPSEPMDRGKVLSAEDLQRIGEFARYRDVDGDGIPYRTLPGTDHPLAAYFTR
FT                   GSGHNEYAQYSERPDDWRRNMERLRRKHETARKLVPKPVIESWADSSVGIVSFGSVHHP
FT                   VMEAIDLLAEKGLSTDYLRIRALPLEETLREFIRKHDRTYVIELNHDGQMVNLIRMEFP
FT                   EVADKVISIAYCDGLPMTANYIANALLEKEC"
     atgagcctgg ctgaagacat aaaagctata cctgtgggta aaacgcctga ggtgatcaac        60
     gacttttcca tagtggcagc gacggtcaac ggctccggaa gtcagacatc taacctgacg       120
     ctgatcagag ccctgtttcg gatggggatt ccggtcaatg gtaagaatct ttttccttca       180
     aatatatcgg ggttgcctac ctggtacacc attagggtca ataaggatgg ttacatagcc       240
     aggaaggaac gagcagagat actcgtagca tttaacccgc agaccgctgc tgaggacata       300
     caggctctgc caccaggagg ggtctgcata taccctgcag agtccaagct gcctttggtt       360
     cgggatgaca tagtatatta ttctgtccca gtaaagcctt ttgtggaagc tactggggct       420
     gatccgaagc tgagagagaa atttgcaagc atggtgtacg taggagcttt agcagagctc       480
     ctgggtattg ataggcaaga gattagagcg gctctctctc agcaatttcg cggcaaggag       540
     aaagttgttg atcagaactt ccaggtgata gtctccgctg ctgattgggt caaagagaac       600
     ataaccaaga aagacccata cagagtggaa aggatggaag ctacaagggg taagatactt       660
     atagatggga acagcgctgc tgctctagga gctatatttg ggggagtaac tgtcgcagcc       720
     tggtatccta taactccttc tactagcttg atagaagcac tacagtctta tctccctaag       780
     ttacgcacgg acaaagatgg taaccataca tatgccgtcg tacaggccga agatgagatg       840
     gcggctttag ggatagtttt aggagctggc tgggccggtg ccagggctat gacttctacc       900
     tccggacccg gaatctcgct gatgacggag tttgcgggat taggcttctt tgctgagata       960
     cctggggtta tctgggatat acagagaata ggtcccagta ccggtctgcc aacgcgagtt      1020
     tcgcagggag atgtgctgaa ggtctacttc cttggacatg gagatacgag acatgtctgc      1080
     ctgatccctg gaactgtagc cgagtgcttt gagtttggct acaaagcttt tgatctggcc      1140
     gaacgcttgc agacgccagt gtttgtgctc agcgatctcg accttggtat gaacctttgg      1200
     atgagtgatc cttttgaata tccatctgaa cctatggata gaggcaaggt gctctctgca      1260
     gaggacctgc aacgcatagg agaattcgcg cgttacagag acgtagatgg agacggaatt      1320
     ccctatagaa ctttgccagg gactgatcat ccacttgctg cctactttac tagaggttct      1380
     ggtcataatg agtacgctca gtatagcgag agaccggatg actggcgaag gaacatggag      1440
     aggttaaggc gtaagcatga gacggctcgc aagttagtcc ctaagccagt aatagagtca      1500
     tgggctgatt cgagtgtagg tatagtcagc tttggatcag tacaccatcc tgtgatggag      1560
     gctattgatc tgcttgcaga gaaaggattg agtactgact acctacgcat aagggctttg      1620
     ccactagagg aaacccttcg cgaattcata aggaaacatg atagaacata tgttatcgag      1680
     cttaaccatg atgggcagat ggttaacctc atacgtatgg aattcccaga agtagcagat      1740
     aaggtaatct ccatagctta ctgcgatggc ctgcctatga ccgctaacta tatagcgaat      1800
     gccctattgg aaaaggagtg ctag                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page