(data stored in ACNUC7421 zone)

EMBL: CP001825.PE333

CP001825.PE333       Location/Qualifiers
FT   CDS_pept        366905..367957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0335"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: glo:Glov_1075 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41257"
FT                   /db_xref="GOA:D1CEA1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA1"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACZ41257.1"
FT                   /translation="METITKPGSSPGRKVNRIGLERTDYRGGVSTLCAGCGHDSISSQI
FT                   MTAAFELSLKPEQIIKLSGIGCSSKSPAYFLGRSHGFNAIHGRMPAVATGATLANRKLL
FT                   AIGVSGDGDTGSIGIGHFKHMVRRNIPLVYIIENNGVYGLTKGQFSATADIGQKLKHAG
FT                   INELPPMDLCMEAIIAGCGFVARSFAGDAKQVRQLLKAAMSFKGTAVIDIISPCVTFNN
FT                   AEDSTKSYPYGKANEEPLHEIGFVPKYEEIVVDYDPGTVKEVELHDGSVIQLRKLDRDY
FT                   DPTNKVEALRLLEEAQANREFITGLIYFNEDRPSFPEVMRLPEKPLAELQEEDLRPPKE
FT                   ALEAIMSGLM"
     atggaaacca taactaagcc tggcagctct cccggaagaa aagtaaacag gataggcttg        60
     gagaggactg attacagggg gggagtctct acactttgcg caggttgtgg gcatgattcg       120
     atatccagcc agatcatgac agcagctttt gagctctcgc tgaagcctga gcagataatc       180
     aagctgagtg gtataggttg ctcgagcaaa tcgccagcct acttcttagg tagatctcac       240
     ggtttcaatg ccatacatgg gcgtatgccg gcggtggcta caggggctac tttagctaac       300
     aggaagttgc tagctatagg agtgagcggt gatggtgata ccggtagcat aggtataggg       360
     catttcaagc acatggttcg tcgtaatatc ccactggtct acataataga aaacaacggc       420
     gtctatggtt tgaccaaggg gcagttctcg gcgacagcgg atataggaca gaaactgaag       480
     cacgcaggta ttaatgagct tcctcctatg gatctatgta tggaggcaat aatagctgga       540
     tgtggttttg tcgccagatc gtttgccggt gacgctaagc aggtccgtca actgttaaag       600
     gctgctatga gcttcaaggg taccgctgtg atagatatta taagcccctg cgtgaccttt       660
     aataatgccg aggacagtac taagagttac ccatatggca aggctaatga ggagcctctg       720
     catgagatag ggtttgtgcc aaagtatgaa gagatagttg tggactatga ccctggcacg       780
     gtgaaagagg tcgagttgca tgatggctct gtaatccagc tacgtaagct ggatagagat       840
     tatgatccta ctaacaaagt tgaagctttg aggctattgg aggaagccca ggcaaacagg       900
     gaatttataa ctgggctgat atatttcaac gaagatagac cttccttccc agaagttatg       960
     cggctgcccg agaagccctt agctgagctt caagaggagg atctgcgccc acctaaagag      1020
     gcacttgagg ctattatgtc aggcttgatg tag                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page