(data stored in ACNUC7421 zone)

EMBL: CP001825.PE334

CP001825.PE334       Location/Qualifiers
FT   CDS_pept        complement(367958..368752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0336"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: swi:Swit_2098 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41258"
FT                   /db_xref="GOA:D1CEA2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA2"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ACZ41258.1"
FT                   /translation="MKLGIVFSPASNWQEIFQAALLADKLGLDSVGFWDHYHSMKPEWG
FT                   YVCGWASYGAIACATERVKLVPMVICNLNYALGVMAKETSMLALISDGRFELGIGAGDY
FT                   PEEYAAWNLPYPDAEFRIALLRENMLALREVWQGKQVTFNGQKVKLQDATCAPPPSKPP
FT                   RIIVGAGKSKKLIRSALEYADEINIYADQELVRYTKRVISNSNKPIGLSVYLHFDWDQW
FT                   PQDISQEIAKWKQVGIDRLFINVGYEWPLQEKVREIASAIID"
     atgaagttag gaatagtatt tagtcctgct agtaactggc aggagatctt ccaggcggca        60
     ctcttagcag acaagttagg gctagattca gtcggcttct gggaccatta tcactccatg       120
     aaacctgaat ggggatacgt ctgtggatgg gcttcctatg gagcaatagc ctgtgctact       180
     gagagggtca aactagtacc tatggttatc tgtaacctta actacgcgct aggtgttatg       240
     gctaaagaga catctatgtt agccttgatt agcgacggta ggttcgagct tggtataggg       300
     gcaggggatt atcctgagga atatgctgct tggaatcttc cttatccgga tgcggagttt       360
     cgcattgcat tactaagaga gaacatgctt gctttgaggg aggtttggca gggcaagcaa       420
     gttacgttta atggacaaaa agtgaagctg caggatgcta cctgtgcccc tcctccttca       480
     aagccaccca ggatcatagt aggtgccggt aaatccaaga agctgatacg ctcagcactg       540
     gaatacgcag acgaaatcaa tatctatgcg gaccaagagc ttgtgagata tacaaagcga       600
     gtaatatcca actctaacaa gcccataggt ctttctgtct acctacactt tgattgggat       660
     caatggcccc aggatatctc ccaagagata gctaaatgga agcaagttgg tatagaccga       720
     ctgtttataa acgtcggcta tgagtggcca ctacaagaaa aggtcagaga aatagcaagc       780
     gcaattatag actga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page