(data stored in ACNUC7421 zone)

EMBL: CP001825.PE335

CP001825.PE335       Location/Qualifiers
FT   CDS_pept        complement(368775..369161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0337"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: bba:Bd3645 putative
FT                   methylated-DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41259"
FT                   /db_xref="GOA:D1CEA3"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA3"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACZ41259.1"
FT                   /translation="MSTPKEAKSFKEIVWKIVSSIPKGKVMTYGQIAALAGYPGSAQVV
FT                   GWILHYTPPELNIPCQRVVNRFGGLAAGYGWGGVYSHKKDLEKDGVEVREDFTVDLQKY
FT                   QWFPPQELVDEWLSFKLERLSQDS"
     atgagcacgc ccaaggaagc caagtctttc aaggagatcg tctggaagat tgtatcctcg        60
     attcccaagg gcaaggtaat gacctatgga cagatagcag cactagcagg ctacccagga       120
     tcagctcagg ttgtaggatg gatcctccac tatactcctc ctgagctaaa tatcccttgc       180
     cagcgggtgg tcaacaggtt cggaggactg gcagcaggct acggatgggg aggagtatat       240
     agtcacaaga aagatctgga gaaagatggt gtagaagtta gagaggactt cactgttgat       300
     cttcagaagt atcaatggtt ccctccacaa gagttagtag acgagtggct aagtttcaag       360
     ctcgagcgat tgagccagga tagctag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page