(data stored in ACNUC7421 zone)

EMBL: CP001825.PE338

CP001825.PE338       Location/Qualifiers
FT   CDS_pept        complement(370587..371198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0340"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   aba:Acid345_3693 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41262"
FT                   /db_xref="GOA:D1CEA6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA6"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACZ41262.1"
FT                   /translation="MHELPPLPYDYNALEPYIDEQTMRLHHDKHHGTYVNNLNQALEKY
FT                   PELQNKSAEDLLRDINSIPEDIRTAVRNNGGGHVNHSMFWVIMKPNGGGEPYGPIADAI
FT                   KQTFGSFEEFKRQFNDAGAKRFGSGWVWLVRTPDGQLQVISTANQDSPLMEGLYPIMGN
FT                   DVWEHAYYLKYQNRRAEYLEAWWNVVNWDEINRRFEQSSK"
     atgcatgagt taccaccact cccatatgat tacaatgccc ttgagcccta catagatgag        60
     cagaccatga ggctccacca tgataagcac catggcacct atgtaaacaa tctcaatcag       120
     gcattagaga aatatccaga gctacagaac aagagtgccg aggacttgct tagggatata       180
     aacagcatac ccgaggatat acgtacggct gtgcgcaaca atggtggtgg tcacgtcaac       240
     catagtatgt tctgggtaat catgaagccg aatggtggcg gggagcctta tggcccaata       300
     gcagacgcta tcaagcagac ctttgggagc ttcgaggagt tcaagaggca gttcaacgat       360
     gctggagcaa agaggtttgg cagcggttgg gtatggcttg tacgcactcc agacggtcag       420
     ctacaggtaa tcagcactgc taaccaggat agcccactta tggaaggtct ttatcccata       480
     atgggcaacg acgtttggga gcacgcttac tacctcaagt atcaaaaccg cagagcagag       540
     tatctggaag cttggtggaa cgtcgtcaat tgggacgaga tcaaccgccg ctttgagcag       600
     tccagcaagt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page