(data stored in ACNUC7421 zone)

EMBL: CP001825.PE34

CP001825.PE34        Location/Qualifiers
FT   CDS_pept        complement(35801..36391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0035"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40958"
FT                   /db_xref="GOA:D1CDF2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF2"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACZ40958.1"
FT                   /translation="MKIGVLALQGDFREHEQMLHRIGIVPVEVRKPEHLYGLDGIIIPG
FT                   GESTTIGKLAVNYGLMEPLKDFAAQGKPVWGTCAGMIFLSKDVGMEQPLLGLLDVKVRR
FT                   NAFGRQLDSFEADIEMPEVSERPVHAVFIRAPIVESVGPGVQVLGKLQDGTIVAVRQGN
FT                   ILATSFHPELTQDPTMHLYFISMAKEDLVTNRS"
     ttgaaaatag gtgttctggc cctgcagggg gactttagag agcatgagca gatgcttcat        60
     aggataggta ttgttcctgt tgaagttagg aagcccgaac acctctacgg actagatggg       120
     atcatcatcc ctgggggaga aagcactact atcgggaagc tggctgttaa ctatggcctg       180
     atggagccat tgaaagattt tgccgctcag gggaagcctg tgtggggtac ctgtgcaggt       240
     atgattttcc tatcaaaaga tgttggtatg gagcagcctt tacttgggct gctcgacgta       300
     aaggtacgcc gaaacgcgtt tggccggcag cttgattcct tcgaagctga catagaaatg       360
     ccggaggtta gcgaacgccc tgtacacgcc gtgtttataa gagctccgat agtggaatcc       420
     gttgggccag gggtacaggt attgggtaag cttcaggatg gtactatagt cgctgtgagg       480
     caaggtaata tactagcgac gtcttttcac ccagagctta ctcaagatcc caccatgcac       540
     ctttacttca tctctatggc aaaggaagat ctggtaacca atagatcttg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page