(data stored in ACNUC7421 zone)

EMBL: CP001825.PE340

CP001825.PE340       Location/Qualifiers
FT   CDS_pept        complement(372116..372706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0342"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   sus:Acid_7860 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41264"
FT                   /db_xref="GOA:D1CEA8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41264.1"
FT                   /translation="MSNQPLDDQAIMERLSRGDLSAMEALYDCYSRAVYSMILRIVQDQ
FT                   QVAEELTQETFFRAWKQAKSFSNDRGKCASWLMSIAHNIAIDEIRRCKARPKSIRSEDS
FT                   SNYLMNLPDSSLEDPDEIIMGGIRRNIVLEALRELPENQRKVLEMSYFGGLTQSEIADK
FT                   VGEPLGTIKTRMRLALQHLRRNLIEKGIKPEQL"
     atgtcgaatc agcccctaga cgaccaggca atcatggagc gactatctcg tggtgattta        60
     tccgccatgg aggctttgta cgactgttac tcaagagctg tctactccat gatattgaga       120
     atcgttcaag atcaacaggt ggctgaggag ctgactcaag agactttctt cagagcttgg       180
     aagcaagcca aaagcttcag taacgaccga ggtaagtgcg ccagctggtt gatgagtata       240
     gctcataaca tagccataga tgagatcagg aggtgcaagg cccgtcccaa atcgattcgc       300
     tctgaagact cctctaacta cctaatgaac ctgccagata gcagcttaga ggatccagat       360
     gagataataa tgggtggtat aaggcgaaat atagtcttag aggctctgag agagcttcct       420
     gaaaaccagc gcaaagttct tgagatgtca tatttcgggg ggcttactca atccgagata       480
     gctgataaag taggtgagcc cttgggcaca atcaagacta gaatgcgctt ggccttgcag       540
     catcttcgca gaaacctaat agaaaaggga atcaagcctg aacagctata g                591
//

If you have problems or comments...

PBIL Back to PBIL home page