(data stored in ACNUC7421 zone)

EMBL: CP001825.PE342

CP001825.PE342       Location/Qualifiers
FT   CDS_pept        373227..373886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0344"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: smd:Smed_3882
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41266"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ41266.1"
FT                   /translation="MPETKILLVRHADVHNPDQIVYGRLPRFRLSKLGEAQAEATAEFL
FT                   SKEDVKYIYTSPMLRARQTAKAIAKYHPDAKLRISKLLAEINTSWQGIPWSQIGANANL
FT                   YEPIKDPENETIEDVAKRMLRIIRTLVRRHPGETVICVSHADPIKIAWVALEGKELTFE
FT                   NIRKPPYPDRASVTTITFNDDHVVSIKYENPAISVRVTPEQESEKKPSRKKVPVGV"
     atgcccgaaa caaagatttt gttggtccgt cacgctgatg tacataaccc tgatcaaata        60
     gtatatggca gacttcctag gttcaggctg agcaaattgg gggaggcgca agccgaagct       120
     actgctgaat ttctctccaa ggaagacgtc aaatacatat ataccagccc aatgctaaga       180
     gccagacaga cagccaaagc tatagctaag tatcatcctg atgccaaatt gaggatttca       240
     aagcttcttg ccgagatcaa taccagctgg cagggtatac cctggtcaca aataggtgcg       300
     aatgctaacc tatacgagcc tatcaaagac ccggaaaatg agaccataga agatgtagcc       360
     aagaggatgc tcaggatcat tagaactctg gtgcgcagac atccgggtga aaccgtgatt       420
     tgtgttagcc acgcagatcc tataaagata gcctgggtag cacttgaggg taaagagctt       480
     acttttgaga acattcgtaa gccaccttat ccagatagag cgtcggttac tacgatcact       540
     ttcaatgacg atcatgtggt tagcattaaa tatgagaatc cggccattag cgttagggta       600
     accccggagc aagagagtga gaagaaaccc agtagaaaaa aggtgccagt gggtgtgtaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page