(data stored in ACNUC7421 zone)

EMBL: CP001825.PE344

CP001825.PE344       Location/Qualifiers
FT   CDS_pept        376441..376812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0346"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41268"
FT                   /db_xref="GOA:D1CEB2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB2"
FT                   /inference="protein motif:PFAM:PF02325"
FT                   /protein_id="ACZ41268.1"
FT                   /translation="MSRIDDDNARSLNEDRIYEERYVEVDRRSLLAYRWARVVYFVFGI
FT                   IEGLIAIRFVLRLLGANPNSQFAALIYNLTAPLLAPFRGLFSEPSFGTAVIEWRSLVAI
FT                   AVYMLLSYVLVRLGYLLFS"
     atgagccgga tagatgatga taacgccaga agtttgaacg aagataggat atacgaggaa        60
     agatatgttg aggtagacag gagaagcctg ttggcctatc gatgggccag ggtcgtgtac       120
     ttcgtatttg ggataataga aggcttgata gccatcaggt ttgtactgag gctgttgggt       180
     gcaaatccta atagccaatt tgcagctctg atctacaacc taacagcccc cctattggca       240
     cccttcagag ggttgttttc tgaacctagc ttcggaacag ccgttataga atggcgctcc       300
     cttgtggcta tagccgtgta tatgttgctt tcctatgttt tagtaaggct tgggtacctg       360
     ctgttctcgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page