(data stored in ACNUC7421 zone)

EMBL: CP001825.PE345

CP001825.PE345       Location/Qualifiers
FT   CDS_pept        376936..377385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0347"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: dvm:DvMF_1241
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41269"
FT                   /db_xref="GOA:D1CEB3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB3"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACZ41269.1"
FT                   /translation="MTIQDKRTSELVDLLRNAGMRVTPQRLEIVSALVHGSHPSAEEIY
FT                   EQVSAKLPTTSLATVYNTLEALKSLGQVLEVRPPQGGIRYDVLRPYGHSHLVCKRCGRV
FT                   EDAPQQILENGEVSLKVPDIGWSDLEIRLDLEGICPYCREVGADG"
     atgaccatac aggacaagcg gacatccgag ctggttgact tgcttagaaa cgctggtatg        60
     cgggttactc ctcagaggct ggagattgtg agtgctttgg tgcatggcag tcaccctagc       120
     gctgaggaga tctacgagca ggtcagcgct aagctgccca ctacaagttt ggcgacggtg       180
     tacaacacct tggaggctct taagtctttg gggcaggtgt tggaggtaag gcctcctcag       240
     ggcggtatta gatatgacgt gcttcgtcca tatggacatt cgcatctggt atgtaagcgt       300
     tgtggcaggg tggaggatgc tccgcagcag atactagaga atggcgaagt gtcgctcaaa       360
     gtcccagata ttggttggtc agatctagaa atcaggctcg acctagaggg tatatgtcca       420
     tattgcaggg aggtgggcgc cgatggctag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page