(data stored in ACNUC7421 zone)

EMBL: CP001825.PE346

CP001825.PE346       Location/Qualifiers
FT   CDS_pept        377378..378121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0348"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; regulatory protein
FT                   MarR; FeoA family protein; SMART: iron dependent repressor;
FT                   KEGG: tcx:Tcr_0904 iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41270"
FT                   /db_xref="GOA:D1CEB4"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB4"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ACZ41270.1"
FT                   /translation="MASSQATETTHVTASMEQYLLAMYCLRRENQPLIGARLAEWLDVS
FT                   PASVTGMIHRMSQEGLVQVGRGKQITLTTKGWQIALTTARRHYLAERLLTDMLGVDWYR
FT                   AHVEAERWQHAITDETEEKLWIALGRPTTCPHGSPIPGTGACFSPHSRKLTDVEVGREL
FT                   IVERISDSATENIDLLKFFQDHLIMPGKKLSVREINSITQAVTVETENGPVALGIEAAR
FT                   QVIVVPAHLFQQRKPPERLRKDSTF"
     atggctagtt cccaagcaac agaaacaacc catgtaactg ccagcatgga acagtacctc        60
     ttggctatgt attgtctccg cagggagaat cagccactca tcggcgctcg tctggctgaa       120
     tggttagatg tgtctccggc atcggtgacc ggcatgatcc acaggatgag ccaggaaggc       180
     ttggtacagg taggcagggg aaagcagatt actctgacga ctaaggggtg gcagatagca       240
     ctcacgactg cacgtaggca ctatctggct gagcggctgc taactgatat gctaggggtg       300
     gattggtaca gagcacatgt ggaagccgag agatggcagc atgcgataac tgatgagacc       360
     gaagagaagc tctggatagc gcttgggagg ccaactacgt gcccccatgg tagccccata       420
     ccaggtacgg gagcatgctt ttctccccat tcccgcaaat taacagatgt tgaagtaggt       480
     cgagagctaa tagttgagcg tatttcagac agtgctactg aaaacatcga tttgctcaag       540
     ttttttcagg atcatctcat aatgcctggt aagaagctga gtgtgaggga aattaactct       600
     attactcagg ctgtaacggt agaaacagag aacggtcctg ttgcactggg gatcgaggct       660
     gctaggcaag ttatagtcgt acctgcccat ctattccagc agcgaaagcc acctgagaga       720
     ctgagaaagg actctacttt ctaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page