(data stored in ACNUC7421 zone)

EMBL: CP001825.PE348

CP001825.PE348       Location/Qualifiers
FT   CDS_pept        complement(379037..379996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0350"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: dal:Dalk_2294 glyoxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41272"
FT                   /db_xref="GOA:D1CEB6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB6"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ACZ41272.1"
FT                   /translation="MYRVYITRKIPEAGLRLLKDHGFELDIWPGDLPPSKEELKRGISQ
FT                   ADAMISLLTDKIDEEVISNARNLKVIANYAVGYDNIDLEAATKAGIVVTNTPDVLTETT
FT                   ADLAWALMLSVARRLIEGVSHVKDGKWRTWEPQLLLGQDVYGATLGIVGMGRIGQAVAR
FT                   RAIGFQMKVLYTSRSEKTGIDAQKVSLDELLAQSDFISLHTPLTKETRHMINKSTLKRM
FT                   KPTAILINTARGPLVDTAALVEALREGQIAGAGLDVTDPEPLPRNHPLLYLPNCIVVPH
FT                   IGSASQRTRDLMSEIAARNVIAVLEGSQAPNQVNILGS"
     ttgtacagag tatacattac gaggaagatt cccgaagcag ggctaaggtt actgaaagat        60
     catggattcg aattagacat atggccaggg gatctgccgc cgagcaaaga agagttgaag       120
     agagggattt ctcaggctga tgctatgata tctctgctga ccgacaagat agatgaagaa       180
     gtaatatcta acgcacgcaa tctcaaggtt atagcaaact acgcagtagg gtacgacaac       240
     atagacctgg aagctgcaac taaagcggga atagtggtca ccaatacgcc agatgtactg       300
     actgagacca cagcagatct tgcatgggca ttgatgctat ccgtggcccg caggcttata       360
     gagggagtct ctcatgttaa agatggcaag tggcgcacct gggaacctca gctgctgctt       420
     ggacaggacg tctacggagc tactctagga atagtgggaa tggggagaat aggacaggct       480
     gtagctaggc gggcaatagg ttttcagatg aaagttctgt acacctcaag atctgaaaaa       540
     acgggcatag atgctcaaaa ggtaagctta gacgaattat tagcacaatc cgacttcata       600
     agccttcata ctcctctcac taaagagacc aggcatatga ttaacaaatc aacccttaag       660
     cgcatgaagc caacggcgat cttgatcaat actgccagag gaccgctagt agacacagca       720
     gccctggtag aagcgctaag agaagggcaa atcgctggtg ccggactcga cgtcacagat       780
     ccagaacctt taccaaggaa ccacccatta ctttacctgc ctaactgtat agttgtacct       840
     cacataggaa gtgcctcaca aaggacacgt gacctaatgt ccgagatcgc agcacgaaac       900
     gtgatagccg tgctggaggg ctcacaagcg ccaaatcaag tcaacatatt aggctcctag       960
//

If you have problems or comments...

PBIL Back to PBIL home page