(data stored in ACNUC7421 zone)

EMBL: CP001825.PE350

CP001825.PE350       Location/Qualifiers
FT   CDS_pept        381028..382395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0352"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sil:SPOA0312
FT                   glutamate-1-semialdehyde 2,1- aminomutase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41274"
FT                   /db_xref="GOA:D1CEB8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB8"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACZ41274.1"
FT                   /translation="MMGHLTRELSAVVDRYIQQRPRSAEIYQRAVEDLPDGVTHDKRFM
FT                   TPFPTYIQRAKGSRKWDVDGNEYVDYVMGHGALLLGHCHPEVTQAVVEQVQKFTHPGGS
FT                   HELEVEWAELVKSLIPSAEKVRFTSSGTEATHMAIRLARAYTGRKKIVKLEGHFHGWHD
FT                   GVAKAQTPPYDRKTPGIPDEISELTLVSPAKLESIEKIFSSDRDIAAIIFEPSGASYGT
FT                   VPLPEGFVQGLKDLSDRYGVLLICDEVVTGFRWSPGGVQALAGIKPDLTTLAKILAGGF
FT                   PGGAVAGRADILDLISHASDPAKRIVHQGTFNANPVSAAAGVECLKIVGSSDVCQQAAS
FT                   KAAVLRSRLNEKFEDLQIPGCAYGESSICHIIIGEEVPNRVRGDLQRPDLPEDVLRTKG
FT                   TNQQLMWLFDLAMMNEGVDLFSGSAFVSSYHTDEDIDLTIDAFVKVVSELKNEGYL"
     atgatggggc atctaacacg ggagctaagt gcggtagtag ataggtacat ccagcagaga        60
     cctagatcgg cagagatata ccagcgtgcc gtagaggatc ttcccgatgg tgttactcat       120
     gacaagcggt ttatgacccc tttcccgaca tatatccaaa gggctaaagg tagtagaaag       180
     tgggatgtgg atggtaatga atacgtagac tacgtcatgg gccatggggc attactgcta       240
     ggccactgtc atcctgaagt aactcaggcc gtggtggagc aggttcaaaa gttcacccat       300
     cctggaggat cccatgagct agaggtagag tgggcggagt tggtcaaatc actgatacct       360
     tctgctgaga aggtaaggtt cacgagctca gggacggaag caactcatat ggctatccgt       420
     ctggccagag cctacacagg caggaagaag atcgtgaagc ttgaggggca ctttcatggt       480
     tggcacgatg gcgtagccaa ggctcaaact cctccctacg acaggaagac tccgggcatt       540
     ccagatgaga tatctgagct cacgctggta tcgccagcca agctggaatc tatagagaag       600
     atatttagct cggatagaga tatagcggca ataatatttg aaccctcggg ggccagctat       660
     ggtacggtgc ctctgcccga aggctttgtg caagggctga aggacttatc tgatcgctat       720
     ggtgtgctgc ttatatgtga cgaggtggtc acaggtttta gatggtctcc cgggggagtg       780
     caggcgttag caggaataaa gcctgatctt accacattgg ccaaaatcct cgcaggaggt       840
     ttccctggag gggctgttgc tggtagggcc gatatcctgg atctgatatc gcatgccagc       900
     gatcctgcca agaggatagt acatcaaggt accttcaatg ccaaccccgt atctgctgcc       960
     gcaggtgttg agtgcttgaa gatagtgggc tcaagcgatg tttgccagca ggcagcaagc      1020
     aaggcagctg tactccgctc gagactcaat gagaagttcg aggatctgca aatacctgga      1080
     tgtgcatacg gcgagagctc tatctgtcac atcataattg gcgaagaggt gcctaatagg      1140
     gttcggggag acttgcaaag gcctgatctg cctgaggatg tgctccgtac caaaggtacc      1200
     aaccagcaat tgatgtggct atttgatctt gcgatgatga atgaaggtgt agatttgttc      1260
     tctggcagtg ctttcgtcag tagttatcat acggatgagg atatagatct gacgatagat      1320
     gcctttgtta aggtggtttc ggagcttaag aatgaaggtt atctatag                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page