(data stored in ACNUC7421 zone)

EMBL: CP001825.PE351

CP001825.PE351       Location/Qualifiers
FT   CDS_pept        382410..383339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0353"
FT                   /product="Asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: peptidase T2 asparaginase 2; KEGG:
FT                   spe:Spro_2851 asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41275"
FT                   /db_xref="GOA:D1CEB9"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB9"
FT                   /inference="protein motif:PRIAM:3.5.1.1"
FT                   /protein_id="ACZ41275.1"
FT                   /translation="MGKFVVVASANGRVGIEEAARVLANGGSALDAVEVGCRLVESNPE
FT                   DHSVGLGGLPNLIGEVELDASIMDGTTLRAGAVAAVKGYEHPISIARKVMELTPHVCLV
FT                   GSGAERFAKEMGFEPTDLLTPESKRLWEERIRGESSDVDPGMIRYHEQIIQWLSLISDP
FT                   EKPAGGTVNFLALDREGNLACGVSTSGWYCKYPGRIGDSPIIGAGNYADSRFAAVGCTG
FT                   RGELAMRIPAAYTVVVRVQRGESLINALCQTMQDINKLEDPYATGLSMVALDKDGNHAA
FT                   VSNRPDTTYVWLEEGMDSYQESPRIYVA"
     ttgggcaagt tcgtggtggt tgctagtgcc aatggaagag ttggcattga ggaagctgcc        60
     agggttttgg caaatggggg tagtgctctc gatgcggtag aagttggctg caggttggta       120
     gagagtaatc ctgaggatca ttcggtcggc ctcggaggtc tgcctaacct gataggcgag       180
     gtggagcttg atgcttcgat aatggatggt acgacactcc gggctggtgc tgtagctgcg       240
     gtcaaggggt acgaacatcc catatctata gctcgcaaag tcatggagct cacgccccat       300
     gtctgcttgg taggtagtgg tgctgaaagg tttgccaaag aaatggggtt tgagccaaca       360
     gatctgctta ccccagaatc caagcggctg tgggaggagc gtatacgagg ggaatcttct       420
     gatgtagatc ctggaatgat ccgctaccat gagcagatta tacagtggct atcgcttata       480
     agcgatcccg agaagcctgc aggtggtacg gttaattttc ttgcgcttga tagggaaggc       540
     aatcttgctt gcggagtaag taccagtggc tggtattgca aatatccagg cagaataggc       600
     gattccccaa ttataggtgc aggcaattat gcagatagta ggttcgctgc tgtgggctgt       660
     actggtaggg gagagcttgc catgaggatt cccgcagctt ataccgtggt ggtcagggta       720
     caaagagggg aatcgctaat caacgctctc tgtcagacga tgcaggatat aaacaaactg       780
     gaagatcctt atgcaactgg gctgagcatg gttgcccttg acaaagatgg caaccatgca       840
     gctgtgtcta atagaccgga tactacatat gtatggttag aggagggaat ggatagctac       900
     caagagtcgc ccaggatata tgtcgcatag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page