(data stored in ACNUC7421 zone)

EMBL: CP001825.PE353

CP001825.PE353       Location/Qualifiers
FT   CDS_pept        384352..385221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0355"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   tdn:Suden_1355 site-specific DNA- methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41277"
FT                   /db_xref="GOA:D1CEC1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC1"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ACZ41277.1"
FT                   /translation="MSSSNKIFFGDNLRVLESLPSNSVNLIYIDPPFNTGRRQVRISMS
FT                   VDRDDQGDRKGFGGYKYLTKVLGKLSFDDIYDDYLAFLEPRLREAHRVLTANGALYFHI
FT                   DYREVHYCKILLDSIFGRDNFLNEIIWAYDYGGRSKRKWPTKHDNILYYVKDRNNYVFN
FT                   ADEIDRLPYMAPSLVGGDKAKLGKLPTDVWWQTIVSPTGKEKTGYPTQKPLAILERIIR
FT                   ASSCPGDIVLDFFAGSGTTGVAAHKLGRSFILVDNNEEAIRVMRSRFRDVPVEFITLED
FT                   YKYEDKAV"
     ttgagttctt caaataagat cttcttcgga gataatctaa gggttctcga aagcctgcca        60
     tctaattctg tcaatcttat atatattgat cccccattca acacaggccg tcgtcaggta       120
     cgcatatcca tgagcgttga tagagatgat caaggtgata ggaagggctt cggtggctat       180
     aagtacttga ctaaggtatt aggcaagtta tcttttgatg acatctacga cgactatcta       240
     gcttttttag agcctagatt gagagaggct catagggtgc tgactgcaaa tggtgcattg       300
     tattttcata tagattatcg cgaggttcac tattgcaaga tccttcttga ttctatcttt       360
     gggagagaca atttccttaa cgagataata tgggcttatg actatggtgg taggagcaag       420
     agaaagtggc ctaccaagca cgataacatc ctttattacg tcaaagacag aaacaactac       480
     gtattcaatg ctgatgagat agatagattg ccctatatgg caccttcttt ggtggggggt       540
     gataaggcta aattaggtaa gttgccaacc gacgtttggt ggcagactat agttagccca       600
     actggaaagg agaagacggg ttatcccaca cagaagccgt tagcaatact tgagaggatt       660
     ataagggcct cttcgtgccc aggcgacata gtgctggatt tctttgctgg gagcggcacg       720
     actggtgtag ctgcccataa gttgggtaga agctttatcc tggttgataa taacgaagaa       780
     gccataagag taatgcgttc aaggttccgt gatgtacctg tggagtttat aacccttgag       840
     gactataaat acgaggacaa agctgtctag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page