(data stored in ACNUC7421 zone)

EMBL: CP001825.PE356

CP001825.PE356       Location/Qualifiers
FT   CDS_pept        388153..389829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41280"
FT                   /db_xref="GOA:D1CEC4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41280.1"
FT                   /translation="MTLKIRQPFLITCLIISALVLSMIAPTLFGGTTSAHGKNPPGNNG
FT                   TIKVDGRDFDDHPNNEPHPGCVFQIDFYGFDKGDYYATVTFETQAPTEPKDQVILQDKV
FT                   FIGEDDASGGGSESGLDASVKYDLSQYLSQYEPHSNQGYHIKLTIHAPGSKGNDVKHKV
FT                   FWVNCKPENPQPTPTPTATPVPSPSVSPSPTPLPSESPTPSPSMSPTPVPTPSIVPSPS
FT                   PSESPLPSPSVSPTPQPSHSPVPSVSPSPSQSPLPSPSNTPIPSNSPSPSVSPSPSPST
FT                   TPVPSPSISPIPSPSPSVAPTPSPSPTAIPSPSPSVSPTPVPSTSPSPSVSPVPTPSPS
FT                   TSPTPSPSESPAPSPTPVPSPSFSPTPSPSESPVPTPVPSVSPTPSPSTTPLPSPSNSP
FT                   KPSPSPSVMPTPVPSPSISPLPSPAPSESPMPTPVPSPSPSATPVPTPQPSPSPSELPA
FT                   PSVSPTPIPSSVPSPLPSPSPSGSPTPIPMPAPSVSPSPSASGVPVPEASPSPSPSHMP
FT                   TVPRTGDGGMASTGSGSSLPVAGYYLGLILVATYMLLRRKW"
     atgacactga aaataagaca accgttttta ataacttgcc taattatttc tgcactagtc        60
     ttatctatga tcgctcccac actctttggt ggtaccacta gtgctcatgg caagaatcca       120
     cctggcaaca atggtacgat caaagtcgat ggtagggatt ttgatgatca tccgaacaac       180
     gagcctcacc cgggttgtgt attccagata gacttttatg ggtttgataa aggagattat       240
     tacgctacag ttacctttga gacgcaggcg cctactgaac ctaaagatca ggtaatactt       300
     caagataaag tgttcatagg tgaagatgac gcttcgggag ggggatcgga gtctggcctg       360
     gatgcttcgg ttaagtatga tctatcgcag tatctttcac agtatgaacc acattctaat       420
     cagggctacc atatcaagct aactattcat gcccccgggt ctaagggcaa cgatgtaaag       480
     cacaaggttt tttgggtgaa ctgtaagccg gaaaatccac agccaacgcc taccccaacg       540
     gcaacccctg ttccatcgcc ttcagtaagc cctagcccaa ctccgttacc aagtgaatcg       600
     ccaactccga gtccatcaat gagtccaact ccagtgccga caccaagcat agtcccatca       660
     ccaagtcctt cggagtctcc gctccccagc ccatctgtga gccctacacc acagccgtct       720
     catagtcctg tgccttcagt tagcccgtct ccgagccaga gtccgctacc tagcccaagc       780
     aatactccaa ttccatctaa cagcccatca ccgagtgtta gcccaagtcc atcaccttca       840
     actacaccag taccaagtcc atcgatatcg ccgataccaa gcccttcacc ttcggtggct       900
     ccgacgccaa gcccatcacc gacggctata cccagcccgt ctccgagcgt gagtcctaca       960
     cctgtgccat ctactagccc gtcaccaagt gtttctccag tgccgacacc aagcccgtct      1020
     acatctccaa ctcctagtcc ctcggagagt ccggcgcctt cgcctactcc tgtacctagc      1080
     ccctcgttca gcccaacacc atcacctagt gagtcacctg tgccaacgcc tgtaccatcc      1140
     gtgtcgccta ctccgtcgcc aagtacgact ccattaccat ctccgagtaa tagcccgaaa      1200
     ccaagcccat caccctcggt aatgccaacg ccggtgccaa gtccatcgat tagcccactg      1260
     cctagcccgg ctccttccga atcgcctatg ccaacacctg tcccatcacc gagtccttca      1320
     gcgactcctg taccgactcc gcaaccgagt ccgagtccat ctgagttacc tgctccatcg      1380
     gtatcaccaa cacctattcc atcttctgtg ccatcaccac taccatcacc aagcccatca      1440
     ggttcaccta cacctatccc gatgcctgct ccaagcgtga gtccttcgcc cagtgcgagt      1500
     ggtgtacctg tcccagaggc atcaccaagc ccgtctccaa gccatatgcc tactgtgccc      1560
     aggactggtg atggagggat ggcgagtact ggctctgggt cttccctgcc agtagcaggc      1620
     tactacctgg gtctaatatt agtagcaacc tatatgctac taaggcgcaa gtggtag         1677
//

If you have problems or comments...

PBIL Back to PBIL home page