(data stored in ACNUC7421 zone)

EMBL: CP001825.PE357

CP001825.PE357       Location/Qualifiers
FT   CDS_pept        389971..391296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0359"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   mca:MCA2192 dolichyl-phosphate-mannose- protein
FT                   mannosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41281"
FT                   /db_xref="GOA:D1CEC5"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC5"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACZ41281.1"
FT                   /translation="MAEIAGKELVEKKEWNSLAIRAIPLLLILVSFAFYLYRLSVPPQY
FT                   IYDEVYHAYTAAQYASGNTDAYLWYKRAPREGVAYEWTHPPLGKLLIADSILIFGDNSF
FT                   GWRFASAVFGAIGIGVAYWLGYSLTGYMVVGLLTSFLLLFDGMYYVQSRTGMVDIFLVV
FT                   FLMLALLMAYKYLTATNGRTRYLFLTGVFIGLAVSTKWNAVYVYAFLGLSLVVCSAYTL
FT                   YKSRAPVSKWLLEAGLLFAFMLLVPAVLYLLSYTQFFLSGNGIKDFFKLQYQMYYYHSH
FT                   LKATHNYQSKWWEWPLTLRPVWYYVKYYPDGRIANIYTNGNPVIYLALIPAVLWAASDW
FT                   IDENWKALLIVVLGFFGAWLPWALVPRIAFAYHFLPSVPFGCVALAYTIRQFLSRGGTW
FT                   RTAAICYCVAVVAMFVFLFPIYSAIPLTRAQFDMRILIPSWR"
     atggcagaga tagcaggcaa agaacttgtt gagaagaagg agtggaactc cctggctata        60
     agagctattc ctctcttgct aatattggtt tcctttgctt tttacttata caggcttagt       120
     gtgcctcctc aatacatcta cgatgaggtt taccatgcct ataccgctgc tcagtatgct       180
     tctggtaata cggatgccta cttatggtac aagagagctc caagagaggg ggttgcctac       240
     gagtggactc atccaccact agggaagctt ctaattgctg attctatact gatctttggt       300
     gacaattcgt ttggttggcg ttttgcttct gctgtttttg gtgctattgg tattggtgtt       360
     gcttactggc tagggtactc ccttaccggc tacatggttg ttgggctgct cacgtctttc       420
     ttgctactgt ttgatggtat gtactatgtg caatcccgta ctgggatggt agatatattc       480
     cttgtagtat ttctgatgct tgcccttttg atggcttata agtacttgac tgctaccaac       540
     ggtagaacta ggtacctgtt cctgactgga gtatttatag gtctggcagt atctaccaag       600
     tggaatgctg tctatgtata tgcgttcctg gggctatcgc tggtagtttg ttcggcatat       660
     accctgtaca agagtagagc ccccgtaagt aaatggctgc ttgaagcagg actactgttt       720
     gcttttatgt tgctagtgcc tgctgtgttg tacttgctct cctataccca gttcttcctt       780
     agtgggaatg gcataaagga tttctttaag ctccaatatc agatgtatta ctaccactcg       840
     caccttaagg ctacacataa ctatcaatcc aagtggtggg aatggccact aactctcaga       900
     cctgtttggt actatgtcaa atactatccg gatggtcgta tagctaacat atatactaac       960
     ggtaatcccg taatctatct tgctctcata cctgctgtgc tatgggccgc ttctgactgg      1020
     attgatgaga actggaaggc tctgcttata gtagttcttg ggttctttgg agcttggcta      1080
     ccttgggcgc ttgttccaag gatagctttt gcttatcact tcctgccatc agtacccttt      1140
     ggatgtgtag ctcttgctta cactattagg caattcctct caagaggggg gacctggaga      1200
     actgcggcta tatgttattg tgtagctgtg gtggctatgt ttgtgttcct gtttccgata      1260
     tattcagcta tcccactaac tagagctcaa ttcgatatgc gcatacttat tcctagctgg      1320
     agatga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page