(data stored in ACNUC7421 zone)

EMBL: CP001825.PE359

CP001825.PE359       Location/Qualifiers
FT   CDS_pept        complement(393254..394507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41283"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41283.1"
FT                   /translation="MTKLKPRLLVFLILCLMVTTLSPLISINRASAAVTTWRALFLVYR
FT                   STDVTFTWNGQTQRVRTSMSSSDLQKALYVIRRVPSTVYNWSRGNTYLSQTIVYPDHPI
FT                   SSVTSLGANGFWVSPLDIKADINKYAPQGRYDSIFVIWRLDTDSGKRVPSLGWGWTVRP
FT                   GPWANGAGYTTVNIPQQHGDWLGRYPEQIFLHEWTHQVTGFYEQLGYRMPNIDRASDYG
FT                   YSREEAGQVFLSDVLSGRVPYGSTYIGVKPSIWASSTPRYLYAAQSSNYLPRVTSLTPG
FT                   TGTSYVGRSYSFTATYYDSNGAKNINKAYIKFQSSYYNRSVKIWYNQDKNKIYMKDLSN
FT                   GVLYSAVPGKDVVLRGNIVQINARYTTVSLSGNQLTIRWSIVFEPRADNNNYRVLASVR
FT                   DDSGAYPDYKLMAYRYVR"
     atgacaaaat tgaaacctag gctcctagta tttctgattt tgtgccttat ggtaacaaca        60
     ttgtctccgc taattagcat caatcgagcc tcggcagctg tcactacttg gagggcactt       120
     ttcttggtat atcgtagtac agatgttacc ttcacttgga atgggcagac gcagagggtg       180
     aggacctcta tgtcctcttc ggacttgcag aaagcactgt acgtcataag gagagtgcca       240
     tctacggttt acaattggtc cagaggcaac acatacctta gccagactat agtctatcca       300
     gatcacccca tatcatcggt tacttccctg ggtgcgaatg gtttctgggt ttcgcccctg       360
     gacataaagg cagatatcaa caagtacgct cctcaaggta ggtacgacag catcttcgtc       420
     atatggaggt tggatactga tagcggcaag cgagtaccta gcctaggttg gggatggact       480
     gtcaggccag gtccttgggc gaatggagca ggttacacaa ccgtaaatat ccctcaacag       540
     cacggagact ggcttggtcg ctacccagag cagatatttc ttcacgagtg gactcaccag       600
     gtaactggtt tctatgaaca gctaggatat agaatgccca acatagatcg agcctcggac       660
     tatggttaca gtcgagagga ggctggacaa gtcttcctct cagacgtact tagcggcaga       720
     gtcccttatg gctccactta cataggggtc aaacccagca tctgggcttc ttccacccct       780
     aggtatctat acgctgcgca atctagtaac tacctgcctc gcgtgacttc tctaacacct       840
     gggacaggta cgagttacgt aggaagaagc tactcattca cggcgaccta ctacgactct       900
     aatggagcca agaatatcaa caaggcttat atcaagttcc agagctccta ttacaacagg       960
     tccgtcaaga tctggtacaa ccaggacaag aacaagatct acatgaagga cctttctaac      1020
     ggggtgttat atagtgcagt gcctggcaaa gatgtagtgc taaggggaaa tatcgtgcaa      1080
     atcaacgcca ggtatactac agtcagtcta tccggcaatc agctaactat tagatggagc      1140
     atagtttttg aaccaagagc cgataacaac aactatcgcg tgcttgcatc agtacgagat      1200
     gactctgggg cttatccaga ctataaattg atggcctata gatacgtacg gtag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page