(data stored in ACNUC7421 zone)

EMBL: CP001825.PE36

CP001825.PE36        Location/Qualifiers
FT   CDS_pept        37541..38287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0037"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="KEGG: bha:BH1486 3'-phosphoadenosine 5'-
FT                   phosphosulfate reductase; TIGRFAM: phosphoadenosine
FT                   phosphosulfate reductase; PFAM: phosphoadenosine
FT                   phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40960"
FT                   /db_xref="GOA:D1CDF4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF4"
FT                   /inference="protein motif:TFAM:TIGR00434"
FT                   /protein_id="ACZ40960.1"
FT                   /translation="MSLVDKIVEEPAKEELDRINAELEDATPQEIIKWAVDRFGDGLIL
FT                   ACSFGGISGMAILDMAVKIKPDIDVFYIDTDFLFPETHQTKEEAIKRYGIKPIAFKTKL
FT                   TPEAQAEKYGDELWKRNPDLCCHIRKVEPTREALKGRSAWITGLRRDQSSTRRNVRPVE
FT                   WDYKFGLYKINPLAYWNEREVWRYIFKHNVPYNPLHDQGYPSIGCTHCTSPVYGSEDSR
FT                   AGRWAGTGKVECGLHIKLPQTESSSQ"
     ttgagcttag ttgataaaat cgttgaagag ccagcaaaag aagagttgga tagaataaat        60
     gctgagctag aagatgcaac accacaagag atcatcaagt gggccgtgga taggtttggt       120
     gatggcttga tcctagcgtg ctccttcggg ggcatctctg gtatggccat tctagatatg       180
     gctgtgaaga tcaagcctga tatagacgtc ttctatatag acactgattt cctgtttcca       240
     gagactcatc agacaaaaga ggaagcgatc aagcgctacg gcataaagcc aatagctttc       300
     aagacaaaac tcacgccaga agcccaggct gaaaagtatg gtgacgagct ttggaagaga       360
     aatccagacc tctgctgcca cattaggaag gtagagccaa ctcgagaggc actcaaaggc       420
     aggtctgcat ggataacagg acttagaagg gatcagtctt caacgcgacg aaacgtacgg       480
     cctgtggagt gggattacaa gtttggactc tacaaaataa acccattggc ctattggaac       540
     gagagggaag tgtggagata tatctttaaa cacaacgttc catataaccc tctacacgac       600
     caagggtacc cgagcatagg atgcacccac tgcacctcgc ctgtttatgg ctcagaagat       660
     agccgtgctg gcagatgggc aggtactggc aaggtggagt gcgggctgca tatcaagctg       720
     cctcagacgg aatcttccag ccagtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page