(data stored in ACNUC7421 zone)

EMBL: CP001825.PE363

CP001825.PE363       Location/Qualifiers
FT   CDS_pept        398490..399506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0365"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; sigma-70 region 4 domain protein;
FT                   KEGG: bha:BH1376 RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41287"
FT                   /db_xref="GOA:D1CED1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED1"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACZ41287.1"
FT                   /translation="MLSEIHDVPFQDPHFSHQYEDLPEEAEYDKQEEDLSEDLDDSVRM
FT                   YLREIGLVPLLTAEQEVELAKKMERGKKAQSVLDSGKYEPEQRDKLLAEVDEGERARRH
FT                   LIEANLRLVVSVAKKHMNRGLSLLDLIEEGNIGLMRATDKFDYRKGFKFSTYATWWIRQ
FT                   AVTRAIADQARTIRLPVHITETMNHLYKASRKLSQELGREPTCEELAEYMGMNPEKVRL
FT                   IMRASRHPLSLEGPVGTDGDSSLGQFIPDSTTETPVDLAIGEVLKRELSKVLNSLTEKE
FT                   RKVMVLRYGLEGSSPHTLEEVGHRLGVTRERVRQIEAKALEKLRKPGKLNHLRDFLD"
     gtgttatctg agatccatga tgtccccttt caagaccccc atttttctca tcaatacgaa        60
     gatctacccg aggaagcaga atacgacaag caggaggagg accttagcga agacttagat       120
     gattccgtgc gtatgtatct tagggagata gggcttgtgc ctctgctcac cgccgaacag       180
     gaggtggagc tggctaaaaa gatggaaagg ggcaagaaag cccaaagtgt tcttgacagt       240
     ggcaaatacg aacccgagca acgcgataaa ctgctcgcag aagtggacga aggggaaaga       300
     gcgagaaggc atcttataga agcaaacctc agactggtcg taagcgttgc taaaaagcac       360
     atgaataggg gccttagcct ccttgatctt atcgaggaag gtaacatagg cctcatgcgg       420
     gctacggata aatttgacta tcgcaagggg tttaagttct cgacctatgc tacttggtgg       480
     atacggcagg ccgttaccag ggctatagca gatcaggcca ggacgataag gcttccagta       540
     cacattacgg aaaccatgaa tcacctctat aaggcctcac gtaagctctc acaggagctc       600
     ggcagggaac ctacatgcga ggaacttgct gagtatatgg gaatgaaccc agagaaggtg       660
     aggctaataa tgagagcgtc tcgccatccg ctttccttag agggtccagt gggaacggat       720
     ggcgattctt ctttagggca gtttatccct gattcgacta ctgagactcc tgtagatctg       780
     gctataggag aagtgcttaa gagggagtta tccaaggttc tgaactccct cacagagaaa       840
     gagcgcaagg taatggtgct gagatatgga ctagaaggct cttcacccca tacactagaa       900
     gaggttggcc ataggcttgg tgttactcgt gaaagggtac gccagataga ggctaaggcc       960
     ctagagaaac ttcgcaagcc tggaaagctc aaccatctaa gggatttcct cgactag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page