(data stored in ACNUC7421 zone)

EMBL: CP001825.PE364

CP001825.PE364       Location/Qualifiers
FT   CDS_pept        399533..400540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0366"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   mxa:MXAN_4674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41288"
FT                   /db_xref="GOA:D1CED2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED2"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACZ41288.1"
FT                   /translation="MGEPIVSEIRVISFGLGPIGSEVARVAASKSNMRLVGAVDIDPSK
FT                   VGRTVEEVTGAPSEVIVSSSLEEALQNTEADLILHTTSSFLEVVKPQIESAIEKGLSVV
FT                   STCEELSYPWRTYPGLATELDMKAKEANVRILGTGVNPGFVMDAFPLTVTTVCQKVDRI
FT                   HIERVVDAGGRRLQLQRKVGAGLTVEEFRQLVATGNVRHVGLPESAWMIIDAMGWECKD
FT                   FEESIEPIVAEREILAAIGNIQPGQVAGVRQTIRAYGRDIEKLVLDLKMYVGADEPVDH
FT                   IQIWGIPDLDLRFDGGVHGDRATASIVVNAASVLMNLPPGLRTMLDVMPLRFRS"
     gtgggagagc ctattgtgtc tgagataaga gtaatttctt tcggtcttgg ccctataggg        60
     tccgaggtgg cgagagtcgc tgcttccaaa agcaatatgc gtctggtcgg cgccgtggat       120
     atagacccat ctaaggtcgg tcgtacagtt gaggaggtaa ctggtgcccc ttccgaggtc       180
     atagttagct cctctctgga ggaagcgtta cagaatactg aagcagatct tatccttcac       240
     acaacttcat ctttcctgga agtagtcaag cctcagatag agtccgccat agaaaaggga       300
     ctaagtgttg tttccacctg tgaggaactt tcttatcctt ggcgtaccta tcccggtctg       360
     gcaactgaac tagatatgaa ggccaaggag gcgaacgtca ggatactggg gactggggtg       420
     aatcctggtt ttgttatgga tgcttttcct ctgacagtga ctacagtttg tcaaaaggtg       480
     gaccgcattc acatagagag ggtggtagat gctggaggta ggcggctgca gctgcaacgc       540
     aaagtgggtg ctgggctgac cgttgaggag tttaggcagc ttgtggccac agggaacgta       600
     aggcatgtag gcttgcctga gtcagcttgg atgatcatcg atgctatggg ttgggagtgc       660
     aaagattttg aggaaagcat agagcccata gttgcggagc gtgagatatt agctgccatc       720
     ggcaacatac agccaggtca ggttgcggga gttaggcaga cgatcagagc ttatggtcgg       780
     gatatagaga agttagtact ggacctaaag atgtacgtag gtgccgatga acctgttgac       840
     cacatacaaa tatggggtat accggatctg gatctgaggt tcgatggtgg cgtgcatggt       900
     gatcgcgcta ctgcctctat agtagttaat gctgcaagcg ttcttatgaa tctgccccct       960
     ggtctgagga ctatgctcga tgtgatgcct ttaaggttcc gcagctag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page