(data stored in ACNUC7421 zone)

EMBL: CP001825.PE365

CP001825.PE365       Location/Qualifiers
FT   CDS_pept        400546..401217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41289"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41289.1"
FT                   /translation="MKHLLSGLLAILIATCWACSPLGFLTQGSGSSKVHLPTPTGFSSP
FT                   AAVVTPTTNSPASTPSVIPSATPSKVISSSIAFESKIYNYTLKLPAGWYGVSGGISSAG
FT                   VRGDVFYPRKPGVEAYITVFAEDLNPGVNLDSYVDASVNNISRIAGVRVQRLGDYRGGL
FT                   ISGQWLAWTDFSKSPEVFYIRQLVWVYGSKAWVMTLRSKDKNLSNYISVLEFMAATWRA
FT                   E"
     atgaagcatc ttctaagtgg gctgcttgct atactaattg ctacatgttg ggcatgcagc        60
     ccacttggat ttctgactca ggggagtgga tcctcaaaag tacatctacc caccccaacg       120
     ggcttcagct cccctgcagc tgttgttacc cctacaacaa atagcccagc ttcgactcct       180
     tctgttatcc ctagtgcaac accatcgaaa gttatatcgt ctagtatagc ttttgaatct       240
     aagatctata actacactct gaagctacct gcaggttggt acggagtaag tggtgggata       300
     agctctgccg gagtaagggg tgatgtgttt tatccgagaa agcctggagt tgaggcttat       360
     attacggtgt ttgccgaaga cctaaatccg ggtgtcaacc tcgatagcta cgtagatgcc       420
     agcgtgaaca atatcagcag gatagccgga gtgagagttc aaagattagg ggattataga       480
     ggtggactta tatcagggca gtggctagca tggactgatt ttagtaagtc acccgaggtg       540
     ttctacatta ggcaactagt atgggtttat ggtagtaagg cttgggtaat gaccttgaga       600
     agtaaggata agaacctctc caactacatt tctgtactgg aatttatggc tgccacgtgg       660
     agggccgagt ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page