(data stored in ACNUC7421 zone)

EMBL: CP001825.PE367

CP001825.PE367       Location/Qualifiers
FT   CDS_pept        401558..403264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0369"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vha:VIBHAR_05108 ATP-binding ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41291"
FT                   /db_xref="GOA:D1CED5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41291.1"
FT                   /translation="MQEDIPIKIESFTWRYRGRKEPAVQSLSLEVKQGDFVVIMGPSGA
FT                   GKSTLAISLNGLIPHFYRGKMEGNVFIFGKSTRDSRVGELARYVGLVFQDFEAQLFSTN
FT                   VALEVAFGPENFCVHPDEIGLRIRESLAKVGLQGFEERRPATLSGGQKQRLAIASVLAI
FT                   QPRVLCMDEPTTDLDPIGKEGVFKIARSLEQEEDVTLIVIEHETEEALNADRIVLMRDG
FT                   QVVADYPAKEMLRKVDLMEECGVMPLQVPQFFSVMGVPEMELPLTPEEGVQEFRRRGYR
FT                   VDEGAYTKLVEEEKSRMESNHEVIIEVRNLSHMYPGGVLALEDVNLNVHKGEFLAILGQ
FT                   NGSGKTTLVKHFNGLLYPTSGSVRVNGEETRKLGIRTLGQHIGYVFQNPDHQIFSDKVY
FT                   DEVAFGLRLRHTPESEIKQRVADALRAVDLEGYEDADPFSLTKGERQRVAVASVLAGNP
FT                   EVLILDEPTTGLDYSQQRSMMELVKRLNESGSTIIVVTHSMWLVAEYADRVVVMKDGRV
FT                   YLSGTVREVFSREEELRDAALKPPQIVSMSNLLGYTVRSVEELVHVTKENR"
     atgcaagaag atatacccat caagattgaa tcttttactt ggaggtaccg tggccggaaa        60
     gagcctgccg ttcagtccct cagcttggaa gtcaagcaag gcgatttcgt agtgataatg       120
     ggtccctctg gtgccggcaa gagtaccctt gccatctctc tgaatggcct gatccctcat       180
     ttctataggg gcaagatgga aggaaacgtc tttatatttg gtaaatccac tcgggatagt       240
     cgggtcggcg agctggctcg ttatgtgggg ctggttttcc aggattttga agctcagttg       300
     ttctccacca acgtggctct tgaagtagct tttggccctg agaatttctg cgtacatcca       360
     gatgaaatag gcttacggat aagagaatcc ttggccaaag tgggtttgca gggttttgag       420
     gagaggcgtc ctgctacctt gtccggtggg cagaaacagc gcttagctat agcatctgtc       480
     ttggctattc agcctagagt tctatgtatg gatgagccca ctaccgatct tgatcccatt       540
     ggcaaggaag gtgttttcaa aatcgctcgc agccttgagc aggaagaaga tgtcacactc       600
     atagttattg aacatgagac cgaagaagcc ctcaacgctg acaggatagt gttgatgaga       660
     gatggtcagg tagtggcaga ttatcctgcc aaggaaatgc tgcgcaaggt agatcttatg       720
     gaagagtgtg gggtgatgcc tttgcaggtg cctcagtttt tcagtgtgat gggcgtacca       780
     gaaatggagc tacctcttac ccctgaagaa ggggtgcagg agtttcgacg ccggggatat       840
     agagtggacg aaggggccta cacgaagctt gtggaagaag aaaagtccag gatggaatct       900
     aaccatgaag ttattatcga ggttcgaaac ctgagccaca tgtatccggg tggagtgctg       960
     gcacttgagg atgtaaacct aaatgttcat aaaggggaat tcttggcgat tcttggccag      1020
     aatggctctg ggaagacaac tctggttaag catttcaatg gtctgttata tccaacctcc      1080
     ggtagtgtca gggtaaatgg tgaggagaca cgcaagctag gtatcaggac actgggacaa      1140
     catataggct atgtctttca gaacccggat caccagatat tttctgataa ggtctatgat      1200
     gaagtcgctt ttgggttgag gctacgccat acacctgaga gcgagatcaa gcagagagtt      1260
     gccgatgcct tgagggcggt cgacttggaa ggatatgaag acgctgatcc attctccctt      1320
     accaaaggtg agcgacagag agtagctgtg gcatctgttc ttgcgggcaa tcccgaggtc      1380
     ctgatcctag atgagcccac cactggcttg gactattccc agcagcgcag catgatggag      1440
     ctagtaaaga ggttgaacga atctggctcg accatcatcg tagtcacaca tagcatgtgg      1500
     ttggttgctg aatatgcgga ccgagttgta gtcatgaagg atggcagagt ttacctgtct      1560
     gggactgtgc gagaggtgtt ctccagggag gaggagctgc gagatgccgc gctaaagcca      1620
     cctcaaatag tgtcgatgag caatctgctg ggctatactg tgcgttcggt tgaggagcta      1680
     gtacatgtca ctaaggagaa tagatag                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page